KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18768Help
Entry
Dpse_GA18768      CDS       T01032                                 

Definition
GA18768 gene product from transcript GA18768-RA (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dpo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dpo00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dpo00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dpo00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 515 aa AA seqDB search
MLRSLATTRNELGTLRAVLLRRPATASLRRGDGQIGVRALSTRLLASARNLQASRSTLKS
SRPQSLNAWSYNFARNYASLPEHLRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEI
ETDKATMGFETPEEGYLAKILIPGGTKDVPIGQLLCIIVNDQASVAAFKDFKDDAPAAAP
APAAAAAPPPPAAAAAAPAPVAAPPPAAAAAPAPAPAGTAQTAADQRGDRVYASPMAKKL
AEAQKLRLQGKGSGVHGSIKSGDLAGQKPAAAAKAAPAKAAPGARYKDIPVTTMRAVIAK
RLLESKTQLPHYYVTVQCQVDNLLKFRAKVNKKYEKQGARVSVNDFIIKATAIASLKVPE
ANSAWMDSVIRQYDDVDVSVAVSTDKGLITPIIFGADRKGVLDISKDVKELAGKARANKL
APHEFQGGTISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKQLVLDPDSPKGFKEVNLL
TVTLSADHRVVDGAVAARWLQHFRDYIEDPQNMIL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcccttgcaacgacacgaaacgaattggggaccctgcgtgcggtgctcctc
cgacgaccagccactgccagcctccgacgcggcgatggccagattggagtgcgtgccctc
agcacccgactgctggccagtgcccggaatctccaagcaagcaggtcgactttgaaaagc
agcaggcctcagtcgctaaacgcctggagctataattttgcccgcaattatgctagcctg
ccggaacatctccgtgtgccgcttcctgccctatcgccaactatggagcgaggctccatt
gtcagctgggagaagaaggagggtgacaaactcaacgaaggtgacctcctttgcgaaatt
gaaactgacaaggcgaccatgggcttcgagacaccagaagaaggctatttggccaaaatc
ctgatacccggcggtaccaaggatgtgcccatcggccagctgctgtgcatcattgtgaac
gatcaggccagcgtggctgctttcaaggatttcaaagatgatgcgcctgctgccgcacca
gcaccagcagcggctgcagcacccccaccaccagcagcagcagccgctgcacctgcacca
gttgccgcaccaccgccagcagcagcagcagcacccgcacccgcacccgcaggtacagcc
cagaccgctgccgaccaacgtggcgaccgggtgtatgccagtcccatggccaagaaacta
gccgaagcacaaaagctgcgcctacaaggcaaaggcagtggcgtccatggctcaattaaa
tccggtgatcttgcaggccagaagcctgctgcagcagcaaaggcggcaccggccaaggca
gcaccaggtgcccgctacaaggacatcccggtgaccaccatgagggcggtgattgccaag
cgtctgctggagtccaagacccagctgccccactactacgtgacggtccaatgccaggtg
gataatctgttaaagttccgtgccaaggtcaacaagaagtatgagaagcagggtgcccgc
gtctctgttaatgatttcatcatcaaggcaactgccatagcgagtctcaaagtcccggag
gccaactccgcctggatggactcggtgatacgccagtacgatgatgtggatgtatctgtg
gccgtctccacggacaagggtctcatcacacccattatatttggagccgatcgcaagggc
gttctggatatctccaaggatgtcaaggagctggctggcaaggcgcgcgccaataagttg
gcgccacatgaattccagggcggcaccatctcagtgtccaacttgggcatgtttggagtc
aaccaattctgtgccgtgatcaatcccccgcaatcgtgcatcttagctatcggcactaca
acgaaacagcttgttctagatccagatagccccaagggtttcaaggaagtcaacctgctg
actgtcactttgagtgctgatcatcgagtggtggatggcgctgtggccgctagatggttg
caacacttccgtgactatatcgaggatccacaaaacatgatattgtaa

DBGET integrated database retrieval system