KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18768Help
Entry
Dpse_GA18768      CDS       T01032                                 

Definition
GA18768 gene product from transcript GA18768-RA (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dpse_GA18768
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dpse_GA18768
   00020 Citrate cycle (TCA cycle)
    Dpse_GA18768
   00620 Pyruvate metabolism
    Dpse_GA18768
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dpse_GA18768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 515 aa AA seqDB search
MLRSLATTRNELGTLRAVLLRRPATASLRRGDGQIGVRALSTRLLASARNLQASRSTLKS
SRPQSLNAWSYNFARNYASLPEHLRVPLPALSPTMERGSIVSWEKKEGDKLNEGDLLCEI
ETDKATMGFETPEEGYLAKILIPGGTKDVPIGQLLCIIVNDQASVAAFKDFKDDAPAAAP
APAAAAAPPPPAAAAAAPAPVAAPPPAAAAAPAPAPAGTAQTAADQRGDRVYASPMAKKL
AEAQKLRLQGKGSGVHGSIKSGDLAGQKPAAAAKAAPAKAAPGARYKDIPVTTMRAVIAK
RLLESKTQLPHYYVTVQCQVDNLLKFRAKVNKKYEKQGARVSVNDFIIKATAIASLKVPE
ANSAWMDSVIRQYDDVDVSVAVSTDKGLITPIIFGADRKGVLDISKDVKELAGKARANKL
APHEFQGGTISVSNLGMFGVNQFCAVINPPQSCILAIGTTTKQLVLDPDSPKGFKEVNLL
TVTLSADHRVVDGAVAARWLQHFRDYIEDPQNMIL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcccttgcaacgacacgaaacgaattggggaccctgcgtgcggtgctcctc
cgacgaccagccactgccagcctccgacgcggcgatggccagattggagtgcgtgccctc
agcacccgactgctggccagtgcccggaatctccaagcaagcaggtcgactttgaaaagc
agcaggcctcagtcgctaaacgcctggagctataattttgcccgcaattatgctagcctg
ccggaacatctccgtgtgccgcttcctgccctatcgccaactatggagcgaggctccatt
gtcagctgggagaagaaggagggtgacaaactcaacgaaggtgacctcctttgcgaaatt
gaaactgacaaggcgaccatgggcttcgagacaccagaagaaggctatttggccaaaatc
ctgatacccggcggtaccaaggatgtgcccatcggccagctgctgtgcatcattgtgaac
gatcaggccagcgtggctgctttcaaggatttcaaagatgatgcgcctgctgccgcacca
gcaccagcagcggctgcagcacccccaccaccagcagcagcagccgctgcacctgcacca
gttgccgcaccaccgccagcagcagcagcagcacccgcacccgcacccgcaggtacagcc
cagaccgctgccgaccaacgtggcgaccgggtgtatgccagtcccatggccaagaaacta
gccgaagcacaaaagctgcgcctacaaggcaaaggcagtggcgtccatggctcaattaaa
tccggtgatcttgcaggccagaagcctgctgcagcagcaaaggcggcaccggccaaggca
gcaccaggtgcccgctacaaggacatcccggtgaccaccatgagggcggtgattgccaag
cgtctgctggagtccaagacccagctgccccactactacgtgacggtccaatgccaggtg
gataatctgttaaagttccgtgccaaggtcaacaagaagtatgagaagcagggtgcccgc
gtctctgttaatgatttcatcatcaaggcaactgccatagcgagtctcaaagtcccggag
gccaactccgcctggatggactcggtgatacgccagtacgatgatgtggatgtatctgtg
gccgtctccacggacaagggtctcatcacacccattatatttggagccgatcgcaagggc
gttctggatatctccaaggatgtcaaggagctggctggcaaggcgcgcgccaataagttg
gcgccacatgaattccagggcggcaccatctcagtgtccaacttgggcatgtttggagtc
aaccaattctgtgccgtgatcaatcccccgcaatcgtgcatcttagctatcggcactaca
acgaaacagcttgttctagatccagatagccccaagggtttcaaggaagtcaacctgctg
actgtcactttgagtgctgatcatcgagtggtggatggcgctgtggccgctagatggttg
caacacttccgtgactatatcgaggatccacaaaacatgatattgtaa

DBGET integrated database retrieval system