KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18786Help
Entry
Dpse_GA18786      CDS       T01032                                 

Definition
GA18786 gene product from transcript GA18786-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dpse_GA18786
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dpse_GA18786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 279 aa AA seqDB search
MLKRKLALRTAELSEAHPKKAPMSEETTSALFAQPPWQQFYNIEVSLNETLETFATPPTI
SCTYNPVEYASSLHCAYLRRFLDGPKRVMFIGMNPGPTGMAQTGIPFGNVRTVSELMEIS
GEVGRPPVIHPKRPVVGLQCKTEERSGVRLWELFLRLAGGRLDTFSRQCFVHNFCPLAFF
DAAGKNITPTELKGPYKQKIRDVCLDALEKQLQIVRPQVVVAVGDYVYQTLKRSEYCKAV
SLLRLAHPSPRSVNNTNWPEKAQEFLEQHGLIQFMRNEV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgaaagctagccctgcggacagcggaactgtctgaggcgcaccccaaaaaa
gctcccatgagtgaagagaccacatctgctctgtttgcacagcccccgtggcagcagttc
tacaacattgaagttagcctcaatgagacgcttgaaacctttgccacgcccccgaccatt
tcatgcacatacaatcccgtggagtacgcgtcatccctgcactgcgcctatttgcgccgc
tttctagatggaccgaagcgcgtcatgttcataggcatgaatccgggccccactggcatg
gctcaaacgggtattccctttggcaatgtgcgcactgtaagcgagttaatggagatctcc
ggagaggtcggaaggccaccagtaatccatcctaagcgaccagttgtgggcttgcagtgc
aaaacagaggagcggagtggggtgcgcttgtgggaactatttctacgtttggcgggcggc
cgactagacacattttcgcgacaatgctttgtgcataacttttgtccacttgccttcttc
gatgctgccggaaaaaacataacaccgaccgagctaaagggtccgtacaagcagaagatc
cgtgacgtttgcttggatgccttggagaagcagttgcagattgtcaggccccaggtggtg
gtagctgtgggcgattatgtgtaccaaacattgaagcgctcggaatactgcaaagcggtg
tctttgctgcgtttggcgcatccaagtccgcgttctgtaaacaacacaaattggccagag
aaggctcaggagtttctggagcagcatggcttgatacagttcatgcgtaatgaggtataa

DBGET integrated database retrieval system