KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18840Help
Entry
Dpse_GA18840      CDS       T01032                                 

Definition
GA18840 gene product from transcript GA18840-RA (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 431 aa AA seqDB search
MCKGGILKNEQWNLQLKDGAVVLLLGSKEDVPEVPTTPIKFIEDMNEAETATAMRLPAGL
TNLGNTCYMNATIQCLKAVPELRDALSNFTSEGSDTLSTAFSISSGMKSVFAQMDKGATV
TPIVLLQALHRASPQFAQTGENGTYRQQDANECWSEILKMLQQKLLPIRQEPSKNITQKT
QHGSFIEQFFGGTFEVKMSTEEAPEETATVTTENFLQLSCFISMEVKYMQSGLKSKMMES
LVKKSETLGRDARYIRTYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFE
LCTPELQQKLCPMRSKFKDLEDKTMELATPKPYGVKEEDIEKKYEQFWFDDDLGSNNSGY
YTLQAVLTHKGRSSSSGHYVAWVRSNGDSWFKFDDDEVTSVATDEILRLSGGGDWHCAYV
LLYGPKRLEKL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaaggtggcatacttaagaatgagcaatggaacttgcagttaaaagatggcgct
gtagtgttattactgggtagcaaagaagatgtaccagaagtacccacaacaccaattaag
tttattgaagacatgaatgaagcagaaaccgcgactgctatgcgcctaccagccggttta
acaaaccttggaaatacctgctatatgaatgccactattcaatgcttaaaagcagttcct
gagcttcgtgatgcgctaagcaattttaccagtgaggggtctgacaccctatcaacagct
ttttctatatcatcaggaatgaaatcggtttttgctcagatggataagggggcaacagtc
actccaattgtactgctgcaggcgttacaccgggcatccccccaatttgcacagaccgga
gaaaatggcacgtacaggcagcaagatgctaatgagtgttggtcggaaattctgaaaatg
ctacaacaaaaacttttaccaattcgccaagaaccatctaaaaatattactcagaaaaca
caacacgggtcatttattgaacaattctttggtggaacctttgaagttaaaatgagcact
gaagaagctccagaagaaactgctactgtaacaaccgagaattttttgcaattaagttgc
ttcatttcaatggaagtaaagtacatgcaaagcggccttaaatcgaaaatgatggaatca
ttggtcaaaaaatctgaaactttgggaagagacgcacgctacattagaacttacttagtt
agccgacttccagcttatcttactgtccaattcgtacgatttcaatataagggaaaagaa
ggcataaatgccaaagtattgaaggatattaaattccccattgactttgacgcgtttgag
ttgtgtacacccgaattgcaacaaaaattatgtccaatgcgatcgaagttcaaggatctg
gaagacaaaaccatggagctggcaacacccaaaccatatggggtcaaggaagaggacatc
gaaaagaaatatgagcaattttggtttgacgatgatttgggaagtaataattctggatac
tatacattacaagctgtattgactcataaaggtcgatcaagttcatccgggcactatgtg
gcttgggttcgttccaacggcgatagttggtttaaatttgacgatgacgaagtaacatct
gtggccacggatgaaattttacgactttcaggtggtggagattggcattgtgcctatgtc
ctattatatggaccgaagcgtttggaaaagctctag

DBGET integrated database retrieval system