KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18840Help
Entry
Dpse_GA18840      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dpse_GA18840
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dpse_GA18840
Ubiquitin system [BR:dpo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dpse_GA18840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
4
AA seq 477 aa AA seqDB search
MPSFKVKVKWGRELFTDIDVNTDEDPILFKAQLFALTGVEPERQKVMCKGGILKNEQWNL
QLKDGAVVLLLGSKEDVPEVPTTPIKFIEDMNEAETATAMRLPAGLTNLGNTCYMNATIQ
CLKAVPELRDALSNFTSEGSDTLSTAFSISSGMKSVFAQMDKGATVTPIVLLQALHRASP
QFAQTGENGTYRQQDANECWSEILKMLQQKLLPIRQEPSKNITQKTQHGSFIEQFFGGTF
EVKMSTEEAPEETATVTTENFLQLSCFISMEVKYMQSGLKSKMMESLVKKSETLGRDARY
IRTYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQQKLCPMR
SKFKDLEDKTMELATPKPYGVKEEDIEKKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSS
SSGHYVAWVRSNGDSWFKFDDDEVTSVATDEILRLSGGGDWHCAYVLLYGPKRLEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttttaaagtaaaagtaaaatggggacgagaactctttacggatatcgatgtt
aacaccgatgaagatcctatattgttcaaagctcaactgttcgctctgactggtgttgag
ccagagcgtcaaaaagttatgtgcaaaggtggcatacttaagaatgagcaatggaacttg
cagttaaaagatggcgctgtagtgttattactgggtagcaaagaagatgtaccagaagta
cccacaacaccaattaagtttattgaagacatgaatgaagcagaaaccgcgactgctatg
cgcctaccagccggtttaacaaaccttggaaatacctgctatatgaatgccactattcaa
tgcttaaaagcagttcctgagcttcgtgatgcgctaagcaattttaccagtgaggggtct
gacaccctatcaacagctttttctatatcatcaggaatgaaatcggtttttgctcagatg
gataagggggcaacagtcactccaattgtactgctgcaggcgttacaccgggcatccccc
caatttgcacagaccggagaaaatggcacgtacaggcagcaagatgctaatgagtgttgg
tcggaaattctgaaaatgctacaacaaaaacttttaccaattcgccaagaaccatctaaa
aatattactcagaaaacacaacacgggtcatttattgaacaattctttggtggaaccttt
gaagttaaaatgagcactgaagaagctccagaagaaactgctactgtaacaaccgagaat
tttttgcaattaagttgcttcatttcaatggaagtaaagtacatgcaaagcggccttaaa
tcgaaaatgatggaatcattggtcaaaaaatctgaaactttgggaagagacgcacgctac
attagaacttacttagttagccgacttccagcttatcttactgtccaattcgtacgattt
caatataagggaaaagaaggcataaatgccaaagtattgaaggatattaaattccccatt
gactttgacgcgtttgagttgtgtacacccgaattgcaacaaaaattatgtccaatgcga
tcgaagttcaaggatctggaagacaaaaccatggagctggcaacacccaaaccatatggg
gtcaaggaagaggacatcgaaaagaaatatgagcaattttggtttgacgatgatttggga
agtaataattctggatactatacattacaagctgtattgactcataaaggtcgatcaagt
tcatccgggcactatgtggcttgggttcgttccaacggcgatagttggtttaaatttgac
gatgacgaagtaacatctgtggccacggatgaaattttacgactttcaggtggtggagat
tggcattgtgcctatgtcctattatatggaccgaagcgtttggaaaagctctag

DBGET integrated database retrieval system