KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18909Help
Entry
Dpse_GA18909      CDS       T01032                                 

Definition
GA18909 gene product from transcript GA18909-RA (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
FoxO signaling pathway
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dpse_GA18909
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dpse_GA18909
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dpse_GA18909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 366 aa AA seqDB search
MSASKTQKFYKLDINRTEWEIPDIYQNLQPVGSGAYGQVSKALVRGTNMHVAIKKLARPF
QSSVHAKRTYRELRLLKHMDHDNVIGLLDIFHPHPANTSLESFQQVYLVTHLMDADLNNI
IRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE
NEMTGYVATRWYRAPEIMLNWQHYNQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPDDFMKKISSESARNYILSLPPMKRRSFKKVFENANPLAIDLVEKMLELDAEKR
ITAEEALAHPYLEKYSEPSDEHTSPLYDQSFEDMDLPVDKWKELIYKEVTNFKPPPSFAQ
VLQEMK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgtcaaagactcaaaagttctacaaattggacataaaccgcacagaatgggag
atacccgacatctaccagaacctgcagcccgtgggttctggtgcctatgggcaggtctcg
aaggctctggttcggggaaccaatatgcatgtggccataaagaagctggcacgccctttt
cagtcgtccgtacatgcgaagcgtacgtatcgagaactgcgactgctgaagcatatggat
catgacaatgtgatcggactgctggacatattccaccctcatccggcgaacacgtcgctg
gagagctttcaacaggtgtacctcgtcacccacttgatggatgcggatctaaacaacatc
atacggatgcagcacctgtccgacgatcacgtacaattcctggtctaccagatactcagg
ggtctaaagtacattcacagtgccggtgttattcatcgcgacctgaagccgtccaacatt
gcagtcaacgaagactgcgagctgcgtattctcgatttcggactggcgcggccaacagag
aacgagatgaccggctatgtggccacacgttggtatcgggccccggagatcatgctcaac
tggcagcactacaaccaaacggtggacatctggtcggtgggctgcataatggcagagctg
atcacacgacgcactctctttccgggcaccgatcatattcatcagcttaatttgatcatg
gagatgctgggcacgccgcccgacgacttcatgaagaagatctcgtcggagagtgctcgc
aattacattttgtcactgccgcccatgaagagacgaagctttaagaaggtgtttgaaaac
gctaatccgttggccattgatttggtggagaagatgctcgagctggatgccgagaagcgc
atcacagccgaagaagccttggcccatccgtacttggagaagtactctgagcccagcgac
gagcatacctcaccgctgtacgatcaaagtttcgaggacatggatctcccagtggacaag
tggaaggaactcatttacaaagaggtcacaaacttcaagccgccaccgtctttcgctcag
gttctacaggaaatgaaatga

DBGET integrated database retrieval system