KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18909Help
Entry
Dpse_GA18909      CDS       T01032                                 

Definition
GA18909 gene product from transcript GA18909-RA (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dpo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 366 aa AA seqDB search
MSASKTQKFYKLDINRTEWEIPDIYQNLQPVGSGAYGQVSKALVRGTNMHVAIKKLARPF
QSSVHAKRTYRELRLLKHMDHDNVIGLLDIFHPHPANTSLESFQQVYLVTHLMDADLNNI
IRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTE
NEMTGYVATRWYRAPEIMLNWQHYNQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPDDFMKKISSESARNYILSLPPMKRRSFKKVFENANPLAIDLVEKMLELDAEKR
ITAEEALAHPYLEKYSEPSDEHTSPLYDQSFEDMDLPVDKWKELIYKEVTNFKPPPSFAQ
VLQEMK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgtcaaagactcaaaagttctacaaattggacataaaccgcacagaatgggag
atacccgacatctaccagaacctgcagcccgtgggttctggtgcctatgggcaggtctcg
aaggctctggttcggggaaccaatatgcatgtggccataaagaagctggcacgccctttt
cagtcgtccgtacatgcgaagcgtacgtatcgagaactgcgactgctgaagcatatggat
catgacaatgtgatcggactgctggacatattccaccctcatccggcgaacacgtcgctg
gagagctttcaacaggtgtacctcgtcacccacttgatggatgcggatctaaacaacatc
atacggatgcagcacctgtccgacgatcacgtacaattcctggtctaccagatactcagg
ggtctaaagtacattcacagtgccggtgttattcatcgcgacctgaagccgtccaacatt
gcagtcaacgaagactgcgagctgcgtattctcgatttcggactggcgcggccaacagag
aacgagatgaccggctatgtggccacacgttggtatcgggccccggagatcatgctcaac
tggcagcactacaaccaaacggtggacatctggtcggtgggctgcataatggcagagctg
atcacacgacgcactctctttccgggcaccgatcatattcatcagcttaatttgatcatg
gagatgctgggcacgccgcccgacgacttcatgaagaagatctcgtcggagagtgctcgc
aattacattttgtcactgccgcccatgaagagacgaagctttaagaaggtgtttgaaaac
gctaatccgttggccattgatttggtggagaagatgctcgagctggatgccgagaagcgc
atcacagccgaagaagccttggcccatccgtacttggagaagtactctgagcccagcgac
gagcatacctcaccgctgtacgatcaaagtttcgaggacatggatctcccagtggacaag
tggaaggaactcatttacaaagaggtcacaaacttcaagccgccaccgtctttcgctcag
gttctacaggaaatgaaatga

DBGET integrated database retrieval system