KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18934Help
Entry
Dpse_GA18934      CDS       T01032                                 

Definition
GA18934 gene product from transcript GA18934-RA (EC:3.1.2.15)
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dpse_GA18934
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dpse_GA18934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 1059 aa AA seqDB search
MPVSMAVCETANVVNAALRESLGVGNGSRAADEAKKTGGGGGDDSDSEMHNQIAVSAYAK
RILMSKIEYEEVPNYHDSVLEQLKNKYIVIKQPSNNNNSSSCNGSNFGNSKVVGANGHDN
GNNGHRKLTQSESTQSGPSPNELPKPKRVLYPRENIRIGWKQSERKWQVGTGMINVGNTC
YLNSTLQALFHIPALANWLVSEQTHLENCNITESNGGCIICAMAKTLQSTQSCQSAMRPF
HIYSKLKQICKHMVVGRQEDAHEFLRFLVEAMEKAYLMRFRNFKELDQLVKETTPLNQIF
GGYLRSEVRCLSCSHVSITFQHFQDLLLDIRKSDTLEEAFDGYFSRERLEDMGYKCEGCK
KKVSATKQFSLERAPITLCIQLKRFSMIGNKLTKTISFKPRIDLSRFAARSPAAAAQPLT
YRLVSMVTHLGVSQHCGHYTAIGMTESGSYYNFDDSYVRPIAMQSVCNTNAYIMFYELDL
SQTTPLKSNGLRLTNGHSQVAVPATVSSSSPTHTRFIGPQLPPGGINGYSNGHATGSSNA
QKTAIQFKQQQQHPQQNGLQVGTGKFQEPPHAKSPLAGAYNKGEAFPATTANGNKSSSSS
ASNSNHNKSVNQLQHQQHYLPISSEDEDSEDGATATATATATARPTAQLPSMPKMTEDSS
DKPKTPLKSSVKTNLVKSLLKTPLKSLVPYESASEEDEPLPNPRKRRSDSDSNDSGDSDP
QPGHVNGHTKTNGGSLTNGNGLGKAKTILATSSSSSLASASASAASDDEDADEEEENSKL
TNGWQPQKQSQSLTQSKAPPSPKTPPSPAVIKSKTGIWKVTRNDDNEDEDDDDDEDEEEQ
HQVVSTPSKNPRNPFAKSSTTPGAKRQKLLNGIAVKSQQQPRVGNGYQSEASTNGNVVNE
LLKQTHRGYGSASVLSWSGKPAELEKELVAEAREQRQHDHDDEEENEMDRGRQRKVKSAT
AKAYNSSTPGYNPFQEYESQKRWHKSSNGGGSFPRYHNQNFRQNFQQRNKFKYNRFGGPG
GAKFQQQRALQRHLASGGVFNRRQPTGQQQQQQSQQSSS
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtttcgatggctgtatgcgaaacggcgaatgtcgtcaacgctgcgctccgcgaa
tcgcttggcgtcgggaacggcagcagggctgctgacgaggccaaaaaaaccggcggaggc
ggcggcgacgactctgactctgaaatgcataatcaaattgctgtcagtgcgtatgcaaag
cggattctaatgtccaaaatcgagtacgaggaggtccccaactaccacgactcggtgctg
gagcagttgaagaacaagtacatagtcatcaagcaacccagcaacaacaacaacagcagc
agctgcaacgggagcaactttggcaacagcaaagttgtgggagcaaatggacacgacaat
gggaataatggccatcgcaagctgacccagtcagagtccacccaatcgggtcccagtccc
aacgagctgccaaaaccaaagcgcgtcctctatccccgagagaacatcaggatcgggtgg
aagcaatcggagcgcaagtggcaggtcggcacgggcatgataaatgtgggcaacacctgc
taccttaactcaacgctgcaggccctcttccacatacccgcattggccaactggctcgtc
tcggagcagacgcatctggagaactgcaacataaccgagtccaatggcggttgcatcatc
tgcgccatggccaagacactacagtcgacgcagtcctgccagtcggccatgcgtccgttc
cacatctactcgaagctgaagcagatctgcaagcacatggtggtgggacggcaggaggat
gcacacgagttcctgcgcttcctggtggaggccatggagaaggcgtacttgatgcgtttc
cgcaacttcaaggagctagatcagctggtgaaggagacgaccccactgaatcagatattc
ggtggctacctgcgcagcgaggtgcgttgcctcagctgcagccacgtctcaatcaccttc
cagcacttccaggaccttctgctcgatatacgcaagtcggacacgctcgaggaggcgttc
gacggttacttctcgagggagcgactcgaagacatgggatacaagtgtgagggctgcaaa
aagaaggtctcggccaccaaacagttcagcctggagcgggcccccatcacgctgtgcatc
cagctgaagcgcttctcgatgatcggcaacaagctgaccaagacgatcagcttcaagcca
cgcattgacctgagtaggtttgctgcccgctcgccggcggctgccgcccagccgcttacc
taccgcctcgtctccatggtcacacacctgggagtctctcagcactgcggccactatacg
gccatcggtatgaccgagtcgggcagctactacaactttgatgacagctacgtgcgcccc
attgccatgcagagtgtgtgcaacaccaacgcctacatcatgttctacgagctggatctg
tcacagaccactccgctcaagagcaatggcttgcgtctgaccaatggccacagtcaagtg
gctgtcccagccacagtctcctcctcctcacccacgcatacacgtttcattggtccccag
ctgccgccaggcggtatcaatggatatagcaatggccatgccactggtagttccaatgcc
cagaagactgccattcagttcaagcagcagcagcagcacccacaacagaacggtctccaa
gtggggaccggaaagtttcaggagcctccgcacgcgaagtctccactggctggcgcatac
aataaaggcgaagcttttccagctacaactgcaaatggtaacaaaagttcctcctcctca
gccagcaacagcaaccacaacaaatcggtaaaccaactacagcaccagcaacattatctg
ccaatatcctccgaggatgaggacagtgaagacggagcgacggcgacggcaacagcaaca
gcaacggccaggccgacggcacagctgcccagcatgcccaagatgacggaggacagcagc
gacaagccaaagactccgttaaagagctcagtcaagaccaatctcgttaagagtctactc
aagacgccactcaagagcctggtgccgtacgagtcggcctccgaggaggatgagccactg
ccgaatccacgaaaacgccgcagcgattcggattcaaacgactcgggcgactcggacccc
cagccgggtcatgtcaatggtcacaccaagaccaacggaggaagccttaccaatgggaat
ggcttgggcaaagccaagactattttggcgacatcctcctcctcgtcattggcgtccgcc
tctgcgtccgccgcatccgatgatgaagatgcagatgaggaagaggagaatagcaagctg
accaacggctggcagccacagaaacagtcacaatcgctgacacaaagcaaagccccgcct
tctcccaagacaccaccctcgccggccgtcattaaatctaagacgggcatctggaaagtc
acccgcaacgatgacaatgaagatgaagatgatgacgacgatgaagatgaggaggagcag
caccaggtggtgtcaacgccatctaaaaaccctcgtaatccctttgccaagtcctcaaca
acacctggcgccaaacggcaaaagctgctcaatggcatcgccgtcaagtcacagcaacag
ccacgcgtgggtaatggctaccagagcgaggcctcaaccaatgggaatgtcgtgaacgaa
ttgctgaagcagacgcatcgcggctacggctccgcctcggtccttagttggagcggaaag
ccagcggaactggagaaggagctggtggcggaggctcgtgagcagcgacagcacgaccac
gacgatgaggaggagaacgaaatggatcgcggacggcagcgcaaagtgaaatccgcaacg
gcaaaggcctacaacagcagcacgcccggctataatccattccaggagtacgagagccaa
aagcgctggcacaagtcaagcaacggcggtggcagcttcccgcgttaccacaatcagaac
tttcgtcagaatttccagcagcgcaacaagttcaaatacaatcggttcggtggacccggt
ggcgccaagttccagcagcagcgggccctgcagcgtcatctggcctccggtggcgtcttt
aaccgtcggcagccgacgggacagcaacagcagcagcagtcacagcagtcttcatcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system