KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19032Help
Entry
Dpse_GA19032      CDS       T01032                                 

Definition
GA19032 gene product from transcript GA19032-RA (EC:3.-.-.-)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dpse_GA19032
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dpse_GA19032
Protein phosphatases and associated proteins [BR:dpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dpse_GA19032
Transcription machinery [BR:dpo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dpse_GA19032
Spliceosome [BR:dpo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dpse_GA19032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 302 aa AA seqDB search
MADVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgtcatgaatatcgacagcataatatcacgtcttctcgaggtgcgtggggca
cggccaggcaaaaacgttcagctctctgagggcgaaattcgtgggctctgcctcaagtcg
cgcgagatattcctctcgcagcccattctgttggagttggaagccccgttgaagatttgc
ggcgacattcacggtcaatactacgacttgctgcgactttttgagtacggtggctttcca
ccggagtcaaattacttgtttttgggcgactacgttgaccgtggcaaacaatcgctggaa
accatctgtctgctcctggcctacaagatcaaatattcggagaacttcttcttgctgcgc
ggcaaccatgagtgcgccagcataaaccgcatctatggattctacgatgagtgcaagcgc
cgctacagcatcaagctttggaagacgtttacggactgcttcaattgtcttcccgtggcg
gccattgttgacgagaagatattctgttgccatggcggtctgagtccggatttgacttcg
atggagcaaatccgacgcattatgcgccccactgatgtcccggatcaaggtctgttgtgc
gatctgctgtggtccgatccggacaaggacaccatgggctggggagagaacgaccgcggc
gtgagcttcacattcggagccgaagtggtggctaaattcttgcagaagcacgagttcgat
ctcatctgccgtgcccatcaggtggtcgaggatggctacgagttctttgcgaagaggcag
ctggtcaccctgttctcggcacccaactactgcggtgaattcgacaatgctggcgccatg
atgtccgtggacgacacactgatgtgctcgttccagatcttgaagccggcagacaaacgt
aaaaagtaa

DBGET integrated database retrieval system