KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19032Help
Entry
Dpse_GA19032      CDS       T01032                                 

Definition
GA19032 gene product from transcript GA19032-RA (EC:3.-.-.-)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dpo03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 302 aa AA seqDB search
MADVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgtcatgaatatcgacagcataatatcacgtcttctcgaggtgcgtggggca
cggccaggcaaaaacgttcagctctctgagggcgaaattcgtgggctctgcctcaagtcg
cgcgagatattcctctcgcagcccattctgttggagttggaagccccgttgaagatttgc
ggcgacattcacggtcaatactacgacttgctgcgactttttgagtacggtggctttcca
ccggagtcaaattacttgtttttgggcgactacgttgaccgtggcaaacaatcgctggaa
accatctgtctgctcctggcctacaagatcaaatattcggagaacttcttcttgctgcgc
ggcaaccatgagtgcgccagcataaaccgcatctatggattctacgatgagtgcaagcgc
cgctacagcatcaagctttggaagacgtttacggactgcttcaattgtcttcccgtggcg
gccattgttgacgagaagatattctgttgccatggcggtctgagtccggatttgacttcg
atggagcaaatccgacgcattatgcgccccactgatgtcccggatcaaggtctgttgtgc
gatctgctgtggtccgatccggacaaggacaccatgggctggggagagaacgaccgcggc
gtgagcttcacattcggagccgaagtggtggctaaattcttgcagaagcacgagttcgat
ctcatctgccgtgcccatcaggtggtcgaggatggctacgagttctttgcgaagaggcag
ctggtcaccctgttctcggcacccaactactgcggtgaattcgacaatgctggcgccatg
atgtccgtggacgacacactgatgtgctcgttccagatcttgaagccggcagacaaacgt
aaaaagtaa

DBGET integrated database retrieval system