KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19044Help
Entry
Dpse_GA19044      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 4813915
NCBI-ProteinID: XP_001353324
FlyBase: FBgn0079042
UniProt: Q2M0U9
Position
XR
AA seq 380 aa AA seqDB search
MRIQCFLLWQISLHCHAIHAEMTATDGRSTPNWWEAVPRVLTDIVTVKANILTAAPLELA
ANAIDMLCSSTLFMDRVPPKITPDINKMHFQYMTPCHNYSVPLLDAAKLWNHSKFGKGRK
VVILATGWTNTVNESSAIAMISRAFMCRRDVNFVIVDAADYVDTLYSWSALNTDLIGEHI
AVGLTHLIELTPLRNIHLIGHSLGAHIMGTAGRTFKRLTGRLVPRITGLDPAKPCFRQEH
ILPGLTRGDAQLVDVIHTNIGILAKRGPLGDVDFYPGGAHPIQPGCLTIGCSHTRAVEYF
AESAYPQQEKNFMGTKCSSWDELRRRDCRAGAGTPSSMGYIIDRKARGIYYVDVNGWPPY
GRSSSKTANPRSKICHLCRT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcggattcagtgttttctcctctggcaaatctcattgcattgtcatgccatacacgcc
gagatgacagcaactgatggcagatctacaccaaattggtgggaggcagtgcccagagtc
ctgaccgacattgtgacagtgaaagcgaatatcctcacggctgctcctctcgagctggca
gccaatgcgatagatatgctgtgctcttccacgctgtttatggacagagtaccgccgaag
atcactccagatataaataaaatgcactttcagtacatgacgccctgccacaactacagt
gttccactgctggatgcagcgaagctctggaatcactccaagtttggcaagggtcgcaag
gtggtcatcttggcgaccggctggacaaacactgtcaacgaatcctccgccatcgccatg
atttcgagggccttcatgtgtcgccgcgatgtgaactttgttattgttgacgctgccgat
tacgtggacacactgtactcttggtcggccctaaacacggaccttattggcgagcacatt
gctgttggtctaacgcatttgatagagctcactcccctgcgaaatatccacttgatcgga
cattcgttgggggcacacattatgggtactgctgggcgcacatttaagcggcttactggc
cgactggtaccccgtataacaggtctggaccccgcgaaaccctgttttcggcaggaacac
attctgccgggactgacccggggagatgcgcagctggtggacgtcatccataccaacatt
ggtattctggcgaagcgtgggcccctgggcgatgtagatttctatccgggtggagcacat
cccatacagcccggttgcctgaccatcggctgctctcatacacgcgccgtagagtacttt
gcagagagtgcatatccccaacaggagaagaactttatgggcaccaaatgcagttcttgg
gatgagctccgacgacgcgactgcagggcgggcgcgggcacaccttcctcgatgggatac
ataattgacagaaaagcgagaggcatctattacgtagatgtgaatggatggcccccgtat
ggtcggagtagtagtaagactgcaaatcccagatcaaagatttgccacctttgccggaca
tga

DBGET integrated database retrieval system