KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19121Help
Entry
Dpse_GA19121      CDS       T01032                                 

Definition
GA19121 gene product from transcript GA19121-RA (EC:1.-.-.-)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dpse_GA19121
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Dpse_GA19121
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Dpse_GA19121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 690 aa AA seqDB search
MTNTDLKALELLFQRPLEPVFTTRDQGKVVLELPDSFYTDRYRNDTVAVSNRFSQDVDLK
IPVQELANKPNLDFAKKLGRKNQFSLFNDRHKEIASQLITLFMGAPNLKQFVALAAYTKD
RLNPVLFQYSYAVAIAHRPDTREVPITNISQVFPSNFVEPSVFRDAREEAAVIGDSGERI
HVDIPRNYTASDREDEQRLAYFREDIGVNSHHWHWHLVYPTTGPMEVVNKDRRGELFYYM
HHQILARYNVERFCNNLKRLQPLNNLRIEVPEGYFPKILSSVNNRTYPARVSNQLLKDVD
REDATIEIGEVERWRDRVLAAIDQGFVEDASGNRTPLDDVQGIDILGNMIEASPVLSINS
QFYGNLHNQGHTIISFAHDPDARHLEEFGVMGDVTTAMRDPIFYRWHGFIDSIFNKFKAR
LDPYNAAQLGFDGVSVTYVEAKIGKGNARPNTLLTYWQKSSADLAAGLDFGPSADGNIFA
SFTHLQNAPFTYTFNVTNNGARRTGTCRIFICPKVDERNQPLRLEDQRLMAIEMDKFTVE
LLPGENTVRRQSTESSVAIPFERSFRPIGAAYQPKAADELARFRFCGCGWPQHLLLPKGN
AQGMLFDLFVMISDYSQDSVQQPNTPNDACSTAYSFCGLKDKLYPDRRTMGFPFDRRLPN
ANLTELVGAFQNMAKTDLRIVFNDRVVDKP
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatacggatctgaaagccttggagctgctgttccagcgtcccctggagccggtg
ttcaccactcgggaccagggaaaggtggtgctcgagttgccggacagcttctacacggat
cgctatcgcaacgacactgtggcagtgtccaatcgtttctcgcaggatgtggacctgaag
atccccgtgcaggagttggccaacaagccaaatctggactttgccaagaagttgggccgg
aagaaccagttctcgctgttcaacgatcgccacaaggagatcgccagtcagctgatcacc
ttgttcatgggtgcccccaatctgaagcagttcgtggccctggcagcctacacgaaggat
cgcctgaatccggttctcttccagtactcttatgccgtcgccattgcccatcgcccggat
acgcgtgaagtgcccatcaccaacatttcgcaggtgtttcccagcaactttgtggagccc
tccgtcttccgcgatgcccgggaggaggcggcggtgatcggcgacagtggggagcgtatc
cacgtggacataccgcgcaactacacggcttcggaccgcgaggatgaacagcgcctggcg
tacttccgcgaggacatcggcgtcaacagccatcactggcactggcacttggtgtacccc
accaccgggcccatggaggtggtcaacaaggatcgtcgtggcgagctcttctactacatg
caccaccagatcctggcccgctacaacgttgagcggttctgcaacaacctgaagcgcttg
cagccgctgaacaatctgcgaatcgaggtgcccgagggctacttccccaagatcctctcc
agcgtgaacaaccgcacgtatccggctcgagtgtccaatcagctcctcaaggacgtggat
cgcgaggatgctaccattgagattggcgaggtggagcgctggcgcgatcgcgtcctggct
gccatcgatcagggctttgtcgaagatgcttctggcaatcgcactcccttggacgatgtc
caaggcatcgatattctgggcaacatgatcgaggcatcgccggtgctgtccatcaacagc
cagttctacggcaatctgcacaaccagggccacaccatcatctcgttcgcccacgatccc
gatgcacggcacttggaggaattcggcgtgatgggggatgtgaccacggccatgcgcgat
ccgatcttctacaggtggcacggattcattgactccattttcaacaagttcaaggctcgc
ctggatccctacaatgccgcccagctgggcttcgacggcgtcagcgtgacctacgtggag
gcgaagatcggcaagggcaatgccaggccgaacaccctgctcacctactggcagaagtcc
agtgcggatctcgccgctggcctggactttggcccgtccgctgacggcaacatctttgcc
tcgttcacccacttgcagaacgctcccttcacctacaccttcaacgtgaccaacaatggg
gcacgccgcacgggcacgtgccgcatcttcatctgccccaaggtggatgagcgcaaccag
ccgctgcgactggaggatcagcgactcatggccatcgagatggacaagtttaccgtcgaa
cttttgcctggagagaacaccgttcgtcgccaatccacggagtcctcggtggccattccg
ttcgagcgctccttccggcccattggcgccgcctaccagcccaaggccgccgacgagctg
gcccgcttccgtttctgcggctgtgggtggccgcagcatctgcttctgcccaagggcaat
gcccagggcatgctcttcgatctattcgtcatgatttccgactactcgcaggactctgtg
cagcagcccaatacacccaacgatgcctgcagcaccgcctactccttctgcggcctcaag
gacaagctgtacccggacagacgcaccatgggcttccccttcgacaggcgcctgcccaat
gccaatctgactgagctggtcggcgccttccagaacatggccaagaccgatctgaggata
gtgttcaacgaccgtgtggtggacaagccctaa

DBGET integrated database retrieval system