KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19121Help
Entry
Dpse_GA19121      CDS       T01032                                 

Definition
(RefSeq) GA19121 gene product from transcript GA19121-RA (EC:1.-.-.-)
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 690 aa AA seqDB search
MTNTDLKALELLFQRPLEPVFTTRDQGKVVLELPDSFYTDRYRNDTVAVSNRFSQDVDLK
IPVQELANKPNLDFAKKLGRKNQFSLFNDRHKEIASQLITLFMGAPNLKQFVALAAYTKD
RLNPVLFQYSYAVAIAHRPDTREVPITNISQVFPSNFVEPSVFRDAREEAAVIGDSGERI
HVDIPRNYTASDREDEQRLAYFREDIGVNSHHWHWHLVYPTTGPMEVVNKDRRGELFYYM
HHQILARYNVERFCNNLKRLQPLNNLRIEVPEGYFPKILSSVNNRTYPARVSNQLLKDVD
REDATIEIGEVERWRDRVLAAIDQGFVEDASGNRTPLDDVQGIDILGNMIEASPVLSINS
QFYGNLHNQGHTIISFAHDPDARHLEEFGVMGDVTTAMRDPIFYRWHGFIDSIFNKFKAR
LDPYNAAQLGFDGVSVTYVEAKIGKGNARPNTLLTYWQKSSADLAAGLDFGPSADGNIFA
SFTHLQNAPFTYTFNVTNNGARRTGTCRIFICPKVDERNQPLRLEDQRLMAIEMDKFTVE
LLPGENTVRRQSTESSVAIPFERSFRPIGAAYQPKAADELARFRFCGCGWPQHLLLPKGN
AQGMLFDLFVMISDYSQDSVQQPNTPNDACSTAYSFCGLKDKLYPDRRTMGFPFDRRLPN
ANLTELVGAFQNMAKTDLRIVFNDRVVDKP
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatacggatctgaaagccttggagctgctgttccagcgtcccctggagccggtg
ttcaccactcgggaccagggaaaggtggtgctcgagttgccggacagcttctacacggat
cgctatcgcaacgacactgtggcagtgtccaatcgtttctcgcaggatgtggacctgaag
atccccgtgcaggagttggccaacaagccaaatctggactttgccaagaagttgggccgg
aagaaccagttctcgctgttcaacgatcgccacaaggagatcgccagtcagctgatcacc
ttgttcatgggtgcccccaatctgaagcagttcgtggccctggcagcctacacgaaggat
cgcctgaatccggttctcttccagtactcttatgccgtcgccattgcccatcgcccggat
acgcgtgaagtgcccatcaccaacatttcgcaggtgtttcccagcaactttgtggagccc
tccgtcttccgcgatgcccgggaggaggcggcggtgatcggcgacagtggggagcgtatc
cacgtggacataccgcgcaactacacggcttcggaccgcgaggatgaacagcgcctggcg
tacttccgcgaggacatcggcgtcaacagccatcactggcactggcacttggtgtacccc
accaccgggcccatggaggtggtcaacaaggatcgtcgtggcgagctcttctactacatg
caccaccagatcctggcccgctacaacgttgagcggttctgcaacaacctgaagcgcttg
cagccgctgaacaatctgcgaatcgaggtgcccgagggctacttccccaagatcctctcc
agcgtgaacaaccgcacgtatccggctcgagtgtccaatcagctcctcaaggacgtggat
cgcgaggatgctaccattgagattggcgaggtggagcgctggcgcgatcgcgtcctggct
gccatcgatcagggctttgtcgaagatgcttctggcaatcgcactcccttggacgatgtc
caaggcatcgatattctgggcaacatgatcgaggcatcgccggtgctgtccatcaacagc
cagttctacggcaatctgcacaaccagggccacaccatcatctcgttcgcccacgatccc
gatgcacggcacttggaggaattcggcgtgatgggggatgtgaccacggccatgcgcgat
ccgatcttctacaggtggcacggattcattgactccattttcaacaagttcaaggctcgc
ctggatccctacaatgccgcccagctgggcttcgacggcgtcagcgtgacctacgtggag
gcgaagatcggcaagggcaatgccaggccgaacaccctgctcacctactggcagaagtcc
agtgcggatctcgccgctggcctggactttggcccgtccgctgacggcaacatctttgcc
tcgttcacccacttgcagaacgctcccttcacctacaccttcaacgtgaccaacaatggg
gcacgccgcacgggcacgtgccgcatcttcatctgccccaaggtggatgagcgcaaccag
ccgctgcgactggaggatcagcgactcatggccatcgagatggacaagtttaccgtcgaa
cttttgcctggagagaacaccgttcgtcgccaatccacggagtcctcggtggccattccg
ttcgagcgctccttccggcccattggcgccgcctaccagcccaaggccgccgacgagctg
gcccgcttccgtttctgcggctgtgggtggccgcagcatctgcttctgcccaagggcaat
gcccagggcatgctcttcgatctattcgtcatgatttccgactactcgcaggactctgtg
cagcagcccaatacacccaacgatgcctgcagcaccgcctactccttctgcggcctcaag
gacaagctgtacccggacagacgcaccatgggcttccccttcgacaggcgcctgcccaat
gccaatctgactgagctggtcggcgccttccagaacatggccaagaccgatctgaggata
gtgttcaacgaccgtgtggtggacaagccctaa

DBGET integrated database retrieval system