KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19136Help
Entry
Dpse_GA19136      CDS       T01032                                 

Definition
GA19136 gene product from transcript GA19136-RA (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dpo00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 472 aa AA seqDB search
MKTAVLGGGLSGLSAGYYLLRRFGNPLTIYEASPRVGGWIRTEARRDRDFIFETGPRTIR
PVGIPGANTLEMMEELQLPLKPIPRSHVAARNRMLYAKGQLCMLPNSPRGLFGVKPPFTQ
PLYKALLHDLSTGRTLASNEDESIYSFAERRFGKEIADYAISPMICGICAGDAKQISVRF
LMEGLFEKEQKYGGVLKGVLYSRFEDNVDEKKQGLFAQDQPKLYAQALQEKWAMYSIEGG
LEVLPRAMRKYLGQHDVNVQLSNACQTLTFSKSGVRMSLRNADVPVDHVVSSLPAYKLAP
LLKPQHPSLCEQLLEIPYVDVVVVNIQYNGNQLKQDGFGLLVPPVEKLPILGIIFDSCCF
DMNGNTVLTVMMGGHWFDQWFGHQPSQKQILDIAKKYVRQILDIQEEPKFSRVHILPKCI
PQYTVGHKERVKRIRKYLKDYKLPLSLCGAAFDGVGINDVILSARRQVDAIP
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggccgtgctgggcggcggcctgagtggcctctccgccggttattacctgttg
cggcgattcggcaatcctctgaccatctacgaagcctccccgcgagtcggtggctggata
cggacagaggcgcgcagggatcgcgactttatatttgagactggaccacgcactatacgt
cccgttggtatacctggagccaatacgctggagatgatggaggagctgcagttgcccctg
aagccaatccctcggagtcatgtggcggctcgcaatcgcatgctgtatgccaagggccag
ctgtgtatgctgcccaatagtcccagaggactgtttggcgtcaagccgccattcactcaa
cccctgtataaggcactgctccacgatctgtccacggggaggactctggccagcaacgag
gacgagtcgatatacagctttgccgagcgccgctttggcaaggagatagccgactacgcc
atcagccccatgatctgtggcatttgcgccggcgatgccaagcagatcagcgttcgcttc
ctaatggagggacttttcgagaaggagcagaaatacggcggcgtgctcaagggcgtccta
tattcccgcttcgaggataatgtagacgagaagaagcagggactgtttgcccaagatcag
cccaaactctatgcccaggccctgcaggagaagtgggcgatgtacagcatcgagggtgga
ttggaggtactgcctcgagccatgcgcaagtatctcggccaacacgacgtcaacgtgcag
ctaagcaacgcgtgccagactttgacattcagcaaaagtggagtccgcatgtctctacgc
aatgctgatgtccctgtggaccatgtcgtgagctctctgccagcctacaaactggctcca
ctcttgaagccacagcacccctcgctgtgcgagcagctcctggaaattccctatgtggat
gtagtggtcgtcaacattcagtataatggcaatcagctcaagcaggacggcttcggtctg
ctggtgcctcccgtcgaaaagctgcccattttgggtattatctttgacagctgctgcttt
gacatgaacggaaacacggtgctaaccgtgatgatgggcggtcattggttcgaccaatgg
tttggccatcaacccagccagaagcaaattctcgatattgccaaaaagtacgtgcgccag
atactcgacatccaggaggagcccaagttcagtcgcgtccacattctccccaagtgcatt
ccacagtataccgtgggccacaaggaacgcgtgaagaggatccgcaagtatctgaaggac
tacaagctgcccttgtcgctgtgcggtgctgccttcgatggcgtaggcatcaacgatgtt
atattgtcggctcgtcgtcaggtggacgccataccgtag

DBGET integrated database retrieval system