KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19136Help
Entry
Dpse_GA19136      CDS       T01032                                 

Definition
GA19136 gene product from transcript GA19136-RA (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dpse_GA19136
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dpse_GA19136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 472 aa AA seqDB search
MKTAVLGGGLSGLSAGYYLLRRFGNPLTIYEASPRVGGWIRTEARRDRDFIFETGPRTIR
PVGIPGANTLEMMEELQLPLKPIPRSHVAARNRMLYAKGQLCMLPNSPRGLFGVKPPFTQ
PLYKALLHDLSTGRTLASNEDESIYSFAERRFGKEIADYAISPMICGICAGDAKQISVRF
LMEGLFEKEQKYGGVLKGVLYSRFEDNVDEKKQGLFAQDQPKLYAQALQEKWAMYSIEGG
LEVLPRAMRKYLGQHDVNVQLSNACQTLTFSKSGVRMSLRNADVPVDHVVSSLPAYKLAP
LLKPQHPSLCEQLLEIPYVDVVVVNIQYNGNQLKQDGFGLLVPPVEKLPILGIIFDSCCF
DMNGNTVLTVMMGGHWFDQWFGHQPSQKQILDIAKKYVRQILDIQEEPKFSRVHILPKCI
PQYTVGHKERVKRIRKYLKDYKLPLSLCGAAFDGVGINDVILSARRQVDAIP
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggccgtgctgggcggcggcctgagtggcctctccgccggttattacctgttg
cggcgattcggcaatcctctgaccatctacgaagcctccccgcgagtcggtggctggata
cggacagaggcgcgcagggatcgcgactttatatttgagactggaccacgcactatacgt
cccgttggtatacctggagccaatacgctggagatgatggaggagctgcagttgcccctg
aagccaatccctcggagtcatgtggcggctcgcaatcgcatgctgtatgccaagggccag
ctgtgtatgctgcccaatagtcccagaggactgtttggcgtcaagccgccattcactcaa
cccctgtataaggcactgctccacgatctgtccacggggaggactctggccagcaacgag
gacgagtcgatatacagctttgccgagcgccgctttggcaaggagatagccgactacgcc
atcagccccatgatctgtggcatttgcgccggcgatgccaagcagatcagcgttcgcttc
ctaatggagggacttttcgagaaggagcagaaatacggcggcgtgctcaagggcgtccta
tattcccgcttcgaggataatgtagacgagaagaagcagggactgtttgcccaagatcag
cccaaactctatgcccaggccctgcaggagaagtgggcgatgtacagcatcgagggtgga
ttggaggtactgcctcgagccatgcgcaagtatctcggccaacacgacgtcaacgtgcag
ctaagcaacgcgtgccagactttgacattcagcaaaagtggagtccgcatgtctctacgc
aatgctgatgtccctgtggaccatgtcgtgagctctctgccagcctacaaactggctcca
ctcttgaagccacagcacccctcgctgtgcgagcagctcctggaaattccctatgtggat
gtagtggtcgtcaacattcagtataatggcaatcagctcaagcaggacggcttcggtctg
ctggtgcctcccgtcgaaaagctgcccattttgggtattatctttgacagctgctgcttt
gacatgaacggaaacacggtgctaaccgtgatgatgggcggtcattggttcgaccaatgg
tttggccatcaacccagccagaagcaaattctcgatattgccaaaaagtacgtgcgccag
atactcgacatccaggaggagcccaagttcagtcgcgtccacattctccccaagtgcatt
ccacagtataccgtgggccacaaggaacgcgtgaagaggatccgcaagtatctgaaggac
tacaagctgcccttgtcgctgtgcggtgctgccttcgatggcgtaggcatcaacgatgtt
atattgtcggctcgtcgtcaggtggacgccataccgtag

DBGET integrated database retrieval system