KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19137Help
Entry
Dpse_GA19137      CDS       T01032                                 

Definition
GA19137 gene product from transcript GA19137-RA (EC:3.1.2.15)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dpse_GA19137
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dpse_GA19137
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dpse_GA19137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 901 aa AA seqDB search
MSQLKKLHMTNSLSSLEKLSDITKDLRNINIKLLLSTARKLFMKAEQYRLEGDEEMAYIN
YMKYFNIIKAIRSKPDYTTHKVQVRESLGDTEANRRIMDSLEMIADSLCERYRQLHKPPS
PAAPLNQTETISHSKPQGAASPHATEYARLGVVSCEELYQRISEKSVLVMDCRPSADYER
SHLTYFCAFNVPEELITPGMSAGKLQARLSSTAKASWASRSVKESVVLMDWNSKDAQPAA
NTPIATLLDILKNWDPDVTYRAPIQIVDGGYEYFIMMYPTHCTNPSVQAPKQNNNDMETI
DDIEYPSINDISMKEDISPRDFSPRPDINRASKQAALRTYQQAKPIAEIMREQAEFLQRA
QQNDEQLNSAAKMWKLLIQRKSPSSNFSESDNQLLYKILQLESQAEDYKIENNRLRNDVE
RLKTFQTVAPQQVTPKDAEATRRIELGILERQRLDEQNMRERQEREHQLAIAREAKKHYR
SPSPPPSPPEESSPQDEVSLSLNKPATNGVHDLDLSIKEILDEKPMFDRATKPTASPRNV
ERIVSRARDFSPVIGHNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCLSDKYKNYI
SRSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRSVVGQYQNIFRGVDQQDSHEFLTIL
MDWLHSDLQTLDVSRMRETIGAAEQAWLDFTKAKESIILHLFYGQMKSTVKCVTCNKESA
TYECFSNLSLELPPNANECQLNQCMDMYFSGERIQGWNCPNCKTKRAAIKKLDISKLPPV
LVVHLKRFYADTSNTGSYAKKQNFLSFPLQNLEMSPYIARAESRAAKPKTYQLYAVSNHY
GTMEGGHYTAFCKSPNYGRWYKFDDQVVSTLDTSNVISSAAYILFYTWLPPDTHARCFDD
V
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagttgaagaaattgcacatgacgaacagccttagtagcttggagaagctgtcc
gacataacgaaagacttgcggaacataaacataaaattattgctctccactgctcgcaaa
ctctttatgaaagcggagcagtatcgactggaaggcgacgaggagatggcctacatcaac
tacatgaagtacttcaatataataaaggccattcgcagcaagcctgactatacgacgcat
aaggtgcaggtacgtgagtcgctgggcgacaccgaagcgaaccgtcgtattatggactct
ctcgagatgatagcggactcgctttgcgaacgctacagacagctacataagccgccaagc
cctgcagccccgcttaaccagacagagacaatcagccacagcaaaccgcagggcgccgcg
tccccacatgccacagagtatgctcgattgggcgtagtctcgtgcgaggagctgtaccag
cgtatttctgagaaatccgtgctggtaatggactgtcgaccaagtgccgactacgagagg
tcgcacctcacctacttctgtgcattcaatgtgcctgaagagctcataacgccaggtatg
tcagctggcaaactgcaggctcgtctcagcagcaccgccaaggcctcgtgggcgtcgcgc
tctgtcaaggaatcggtggttctgatggactggaacagcaaggatgcccagccggcggca
aatactccgatagccacgctcctggacatcctgaaaaattgggatcccgatgtcacctac
cgcgcgcccatacagatcgtggatgggggctatgagtacttcatcatgatgtacccgacg
cactgcaccaatcccagtgtgcaggcaccgaagcagaacaacaacgacatggaaaccatt
gacgacatcgagtatccgtcgatcaatgacatttcgatgaaggaagacatcagcccgcgg
gattttagccctcgtccggacatcaatcgggccagcaagcaggccgcactacgcacctac
cagcaggccaagcccatagccgagatcatgcgcgaacaggccgagttcctacagcgggca
cagcaaaacgacgagcagctgaatagtgccgccaagatgtggaagctactcatccagcgg
aagagtccctcgagcaactttagcgaatcggataatcagctgctatacaaaatccttcag
ctggaaagccaagcagaggattataaaatagagaacaatcgcctgcgaaacgatgtcgag
cgcttgaagacgttccagacggtggcaccgcagcaggtgactcctaaggatgcggaggcc
accaggcgcatcgaattggggattttagagcgacaacggctggacgaacagaacatgcgc
gagcgccaggagcgggagcatcagctggccattgcacgtgaggccaagaagcattacagg
tcaccgtcgccaccgccttcaccgccagaagaatcctcaccccaggacgaggtgtctctt
tctctcaacaagccggctaccaatggggttcatgatttggatctgtccattaaagagatt
ctggacgagaagcccatgttcgatcgggctacgaagccgacggcgagtccaaggaatgtt
gaaaggatagtgtcacgggctcgtgatttctcccctgttataggtcacaatgtgggaagg
ggtctcacgggattgaagaatctggggaacacctgctacatgaatagtatactgcagtgc
ctgagcaacacgccccagctgacggagtactgcctatcagacaaatacaagaactacatc
agccgcagcaacaagacaaatggccaggtcatcgaggaggtggcggccctcatcaaggag
ctctggaatggccaatacaagtgcgtggccagtcgggatctgaggtctgtggtggggcag
taccaaaatatctttcgcggcgttgatcagcaagactcgcatgagttcctcactattctg
atggactggctgcattctgatctgcagacgctggacgtgtcgcggatgcgggagaccatc
ggggctgcggagcaggcctggttggattttaccaaggccaaagagagcataattttgcat
ttattttatggccagatgaaaagcaccgtcaagtgtgtgacctgcaacaaggagtcggcc
acctacgagtgcttctcgaatctcagtctcgagctgccgcccaacgcgaacgagtgccaa
ctgaaccagtgcatggacatgtacttcagtggggagcgcatccaaggctggaattgtccg
aactgcaaaacgaagcgtgctgccatcaagaagctggacatatcaaaactgccgccagtg
ctggtggtccatttaaagcgtttctatgcggatacgagcaacactggatcctatgccaaa
aagcaaaactttctgagctttccccttcaaaacctggagatgagtccgtatatagcacgt
gccgagtcgcgtgctgcaaagcccaagacgtaccagctgtatgctgtctcaaatcactat
ggtacaatggagggcggccactacacggcgttctgtaagagccccaattatgggcgctgg
tataagtttgacgatcaagtggtttcgacgctggacacgtcaaatgtcatctcgagtgcc
gcatacattctcttctacacctggctgccccccgatacgcatgcccgatgttttgatgac
gtataa

DBGET integrated database retrieval system