KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19146Help
Entry
Dpse_GA19146      CDS       T01032                                 

Definition
GA19146 gene product from transcript GA19146-RA (EC:5.-.-.-)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dpo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 437 aa AA seqDB search
MRQLSSLLLLAFIASGSVNAFYSPSDGVVELTPSNFDREVVQDDAVWIVEFYAPWCGHCQ
SLVPEYKKLAKALKGVVKVGSVNADSDSTLSGQFGVRGFPTIKIFGSNKRSPTDFNGQRT
AKAIAEAALAEVKKKVQAALGGGSSGGGGGSSSSSDDDVIELTEDNFDKLVLNSDDIWLV
EFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFAAGS
KSASDAQEYQGGRTASDIVSWASDKHTENVPAPELVEITSESTLDSTCEGKPLCIISILP
HILDCDAKCRNKFLATLRTLGDKYKQKLWGWAWAEGGQQPALEESLEVGGFGYPALAVVN
FKKMKFSVLKGSFSKDGINEFLRDISYGRGHTAPVRGAKKPTIVSVDAWDGKDGQLPTEE
DIDLSDIDLDDDVKDEL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagacagctgtcgagccttttgttgttggcattcattgccagtggcagtgtcaatgcc
ttctattcgccctccgatggcgtcgtggagttgacgccctccaatttcgatcgcgaagtc
gtgcaagatgatgccgtctggattgtggaattctatgccccgtggtgcggccactgccag
tctttggtgccggagtataagaagttggccaaagccctaaagggcgtcgtcaaggtgggc
tccgtcaatgccgattccgacagcaccctcagcggccagttcggagtacgtggctttccc
accatcaagatctttggcagcaacaagcgttcgcccacggactttaatggccagcgcaca
gctaaggcaattgcggaggcggctcttgccgaggtaaagaagaaggtgcaagcagctctg
ggcggcggaagcagcggcggcggtggcggaagcagctcatccagcgatgatgatgtcatt
gaactaaccgaagataacttcgacaagctggtgctcaactccgatgacatttggctggtg
gagttcttcgccccgtggtgcggacattgcaaaaatctggcacccgaatgggccaaggct
gccaaggagctcaagggcaaggtgaagctgggcgccttggacgccaccgcccaccagagc
aaggcggccgagtacaatgttcgcggttatccgacaatcaagttcttcgctgccggctcg
aagagtgccagcgatgctcaggaatatcagggcggacgcacagcctcggacattgtcagc
tgggccagtgacaagcacacggagaatgtgcccgctcccgagctggtggaaatcaccagc
gaatccaccctagatagcacctgcgagggcaagcccctgtgcattatctctattctgcca
cacattctagactgcgatgccaagtgccgcaacaagttcctcgccacacttcgcaccctg
ggcgataagtacaagcagaagctgtggggctgggcctgggctgagggtggccagcagccg
gctctggaggagtccctggaagttggaggctttggctatcccgctctggcagtagttaat
ttcaagaaaatgaagttctcagtgctgaagggctccttctccaaggacggcatcaacgag
ttcctacgtgacatctcatacggacgcggtcacacggctcccgtgcgtggcgccaagaag
cccacgattgtcagcgtcgatgcctgggatggcaaggatggccagctacccaccgaagag
gacatcgatctgagcgacattgatctggatgatgatgtcaaggatgagctctag

DBGET integrated database retrieval system