KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19193Help
Entry
Dpse_GA19193      CDS       T01032                                 

Definition
GA19193 gene product from transcript GA19193-RA
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dpse_GA19193
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     Dpse_GA19193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 1023 aa AA seqDB search
MEHGAEPQLASQQDEQRQFICGVIEGFYGRPWTTEQRKGLFRKLKSMGMDSYMYAPKDDY
KHRAYWRELYTVEEADHLSSLIAAAKEAGIAFYYALSPGLDMTYSSPKEIATLKRKLDQV
SQFGCEAYALLFDDIESELSKVDKEVFQTFANAHVSVTNEIFTHLGSPKFLFCPTQYCGT
RAVPTVQESEYLNTLGSKLNNDIDILWTGDKVISKTISIESIQEITEVLRRPPCIWDNLH
ANDYDQKRVFLGPYTGRSPELIPHLRGVMTNPNCEFYANFIAIHSLASWSRCSMDSKMNS
SLSSDIKLETENEDEMPTEFISKNVYHPRVALKNAISDWLPEFFVEKEAWGPITKPQPQV
QMVMPIIPIIPSINTCMSLTTTTTTSTNTRTVPEVNTTQLQALADVCSTVSSSMTPISNP
VMNSLVSPTKVVTNDDIINPIPTTAACNIELPKKIPISIVPVPIMEAKSAEAESVGLNLG
NQIFESIASRGNPAEELEIESKDQELDASLEDEKQEPVASLTVDTMLDDTSLSPLSGGGN
EPMECSSSIASQVSPKEEEITKLVTDDVLMESVNDVHSMHVESTTSSPLSNTEMREQDLE
TTMEASKITTEDLGLLCDLFYLPFEHGSRALKLLEEFNWLKTNANVILKERSSAGGRGEA
SKSTKPEVSEWMQRCENFDVLCGSVGELLIKIANCQNKEICHELYSYVWDISGALSLLNC
YIKWLALGQFPQNMSSYTEGSYTWFSKGWKEAFMSGDQEPWVFRGGLIADLQRLMPVDSG
NDLFVYKLPEQPTANYYLLRPYRNADELDVINICTRTYLQWHSGLDGADNIHINFPLPSS
VANIVADAIVGPYITLNPQLCIVAYDENGALVGYACAALDVTVFRRNLQMCWMAELREKY
PKTMHELDGDDESSVQLNQLLAHFFDQFHNKYDELQDCPAEVSATFPAVLTAATLKEAED
RDSGITKRILTVLLAALRANGCFGVHVCVPDHDPGQLNFYTKIGFVEVFREERSKCIYLG
RRF
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atggaacacggcgccgaaccacagcttgcgtcccagcaggatgagcagcggcagtttatt
tgcggcgtgatcgaaggcttctacggccgcccctggactacggagcagcgcaagggccta
tttcgcaaactcaagtcgatgggaatggattcgtacatgtacgcacctaaagacgactac
aaacaccgagcttactggcgagagctgtacacggtcgaggaagcggatcatctatcgagt
ctgattgcggccgcaaaggaagccggcattgccttctactacgctttgtcgcccggactg
gacatgacctatagcagtccgaaggagatagcgacgctaaaacggaagttggatcaggtc
tcgcaattcggatgcgaggcgtatgccttgcttttcgacgacattgagtcggaactgtcc
aaggtcgacaaggaggtgttccagacgtttgccaatgcccatgtgtcggttaccaatgag
attttcacccatttgggcagtcccaagttcctgttctgcccaacgcagtattgtggcacc
cgtgctgtgccgacagtccaagaatcggagtacttaaacaccctggggtcaaagctcaac
aatgacatcgatattctctggacgggagataaagtaatctcaaagacaatatctattgaa
tccatacaggagataacggaggtcctacgccgtcctccgtgcatctgggacaatttgcat
gccaacgactacgaccagaagcgtgtgttcctgggcccgtacacaggccgatcgcccgag
ctgatcccccacctgcgtggagtgatgaccaatcccaactgtgagttctacgccaacttt
attgctatccactcgcttgcctcttggtcgcgctgcagcatggattccaagatgaacagc
tcgctgagctccgatatcaagctggagactgaaaatgaggatgaaatgcccacggagttt
atatctaaaaacgtatatcatccacgagtggctctcaagaatgccatttcggattggctg
ccggaattctttgtggagaaggaggcctggggacccataaccaagccacagccgcaagtt
caaatggttatgcccattataccgatcataccatcgatcaacacctgcatgagcctgacg
accaccacaaccacatcgacaaacacccggactgtgcccgaagtgaacaccacccagctg
caagcattggcagatgtttgcagcactgtcagttcctcgatgaccccgatatccaatccg
gtgatgaactccctggtgtcgcccaccaaagtggtcaccaatgatgacattattaatccc
ataccgacaacagcggcttgcaacattgagctgcccaaaaagataccaatctccattgtt
ccagtgcccatcatggaggcaaagagcgctgaggctgagtctgtgggcctgaatttgggc
aatcaaatcttcgagtcaatcgcatccagaggtaatccggcagaagaattggaaatcgaa
tcaaaggatcaagaactggacgcatctctggaggatgagaagcaggagcctgtggccagc
ctcaccgtggacacaatgctggatgacacaagtctgagtccgcttagcggcggcggcaac
gagcccatggaatgcagcagcagcatagcctcccaggtctcaccaaaggaggaggagatc
accaagctggtcaccgatgatgtgctcatggagtctgtgaacgatgtgcacagcatgcat
gtggaaagtacaacctcttccccgctatcgaacacagaaatgcgtgaacaggatcttgaa
acgactatggaggcatcaaagataactacggaagatctgggattgctctgtgatttgttc
tatttaccctttgaacatggcagccgggccctcaagctgctggaagagttcaactggctg
aagaccaatgcgaatgtaatcctgaaggagcgctcctcggcaggcggcaggggggaggcc
agcaagagcaccaaacccgaggtaagcgagtggatgcaacggtgcgagaacttcgacgtg
ctctgtggcagcgtcggggagctgctgattaaaatagccaactgccagaacaaggaaatc
tgccatgagctttactcgtatgtttgggacatttctggtgctctatcgctcctgaactgc
tacattaaatggctggccctgggtcagttcccgcagaacatgtcctcctatacggagggt
agctatacgtggttcagcaagggctggaaagaggccttcatgtcgggcgaccaagaaccg
tgggtctttcgcggcggtctgattgccgacctgcagcgtctgatgcctgtggattctggc
aatgatctgtttgtctacaagttgcccgagcagccaacggcaaactattatctcctgaga
ccgtaccgtaatgcagacgagctggacgtgatcaacatctgtacgcgcacatatctgcag
tggcacagcggactggatggcgccgacaacatccacatcaactttcccctgccctcgagc
gtggccaatattgtggccgacgctatcgttggcccatacataacgctaaatccgcagctg
tgtatagtggcgtacgatgaaaacggtgctcttgtgggctatgcctgtgcagccttggac
gtcaccgtatttcggcgtaacttgcaaatgtgctggatggcggagctgcgtgaaaagtat
cccaaaactatgcacgagctggacggcgatgacgagtcaagcgttcagctgaaccagcta
cttgctcattttttcgaccagtttcacaacaagtacgatgagctgcaggactgtcccgcc
gaagtgagcgctacctttccggccgttctgactgctgccactttaaaggaagccgaggat
cgtgatagcggcatcaccaaacgtatacttaccgtcctgctggccgccctgcgtgcaaac
ggatgcttcggtgtgcatgtctgtgtgccagatcacgatcccggacagttgaacttctac
accaagatcgggttcgtcgaggtctttcgcgaggagagaagcaagtgcatctatttggga
cgccgtttctag

DBGET integrated database retrieval system