KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19251Help
Entry
Dpse_GA19251      CDS       T01032                                 

Definition
GA19251 gene product from transcript GA19251-RA (EC:1.-.-.-)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dpse_GA19251
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Dpse_GA19251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 316 aa AA seqDB search
MARLIESNFVPIAVGVVAVVAGALIVHYFLNKKSTKPRREPNRTARLRTLVDPNDKYLLP
LVEKEVLSVDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDDDVGYV
DLVVKVYFKDTHPKFPGGGKMTQHLEKMELGDKISFRGPSGRLQYLGNGTFSIKKLRKDP
PKHVTAKRVNMIAGGTGITPMLQLVREVLKRNDKDKTEMALLFANQSEKDILLRGELDEL
AQKHPGQFKVWYTVDKAAEGWAYSEGFINEDMIAGHLLPASDDTIVLLCGPPPMINFACN
PALDKLNFHPDTRFAY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtctcatcgagagcaactttgtgccaatcgccgtgggagtggtagccgtcgta
gccggcgctctgatcgtccactatttcctgaacaagaagtctactaagccgcgccgggag
ccgaaccgtactgcccgcctccgcaccctggtggaccccaatgacaagtatctgctgccg
ctggtcgagaaggaggtgcttagcgttgacacacgtcgcttccgcttcggcctgccctcc
aagcagcacgttctgggcctgccagtgggccagcacatccacctgattgcgaccattgac
aatgagctgatcatccgtccctacacgcccatctcgtctgacgacgacgtcggctacgtc
gatctggtagtcaaggtgtacttcaaggacacgcatcccaagttccccggcggcggcaag
atgacccagcatctggaaaaaatggagctgggcgacaagatctcgttccgcggaccgtcc
ggccgcctgcagtacctgggcaacggcaccttctctatcaagaaactgcgcaaggacccg
cccaagcacgtgaccgccaagcgggtcaacatgattgccggcggcacaggcatcactccc
atgttgcagctggtccgagaagtgctgaagcgcaacgacaaggacaagaccgaaatggcc
ctgctgtttgccaaccagagcgaaaaggatattctactgcgcggggagctggacgaactg
gcccagaagcatcccggccaattcaaggtctggtacaccgtggacaaggcggccgaaggc
tgggcctatagcgagggtttcatcaacgaggacatgatcgccggacatctgctgccggcc
agcgacgacaccatcgtgttgctctgcggcccaccgcccatgatcaattttgcctgcaat
ccagcgctggacaagctcaacttccacccggacacccgattcgcctactag

DBGET integrated database retrieval system