KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19350Help
Entry
Dpse_GA19350      CDS       T01032                                 

Definition
GA19350 gene product from transcript GA19350-RA (EC:2.4.1.-)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dpse_GA19350
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     Dpse_GA19350
Glycosyltransferases [BR:dpo01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dpse_GA19350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 908 aa AA seqDB search
MYNNNNDGGGGGSANGNTMQQRRKTTTRSRSKQQQQQQCTSENVIEKNQTNGAQNERLHF
RGSSKDSALSTPLLPRSRSTTSAINSPSPLCCNGGLSILNCCRDVNCHLNAPLRGSVESS
RSRRSESRQSSLTATPTTTPKQASPSPTISERSRSCSGSRSRSCSCDGRLVDCHKHSAAA
AAASTAAPQFTVNLSIDLFSWTLFLLAFCTRFYKLATPPHIVFDELHYGKYIAHYMRNIF
FFDQHPPLGKQLIAGLVSLAGYDGNYTFSRIGAAYAPDVPIFWFRFIPALCGSLLAPAVY
RLLLEARLHRWAAALGGLLVVLDNSLLTQSRFVLMESMLLLASTLGIACLLRFQRCRLGS
FQWLCNGSAAGVLLACAGAVKYIGFLALALAGYLLCRHLWQLLYDASLTNRQLWMHALSR
LLLFVGIPIAVYIGVFYVHFRTLHRAGPHDSIMTSAFQASLEGGLASITSGQPLAVVHGS
QITLRHTHGRTCWLHSHAAVYPVRYKDKRGSSHQQQVTCYSFKDVNNWWIVKRPERDDLV
VGEQPDVIQHGDVIQLVHGITSRALNSHDVAAPMTPQCQEVSCYIDYEIKMAGELLWRVE
ILNRNSEGDSWHAIKSEIRLVHESTGAALKFSGRQLPDWGFNQHEVVADRDQVHEDAIWN
VEEHRYTKTQDQRERERQLLSAEMIPTKRTKLSFWAKLLELQTKMFWHGKHLQAHMYSSL
PHEWPLMDKGIAYWLDSQSSAQIYLLGNVLIWYTASAGILVYATLLAFYAVRRRRLCFDV
SQHEWQRFLMAGDTFFVGYMMHYLPYYFVDRTLFLHNYLPAFVFKLLLLCFVVEHLDYLL
RRHCSGRGVHLVRVYRLALLLWLLAVGSVFVKFLPLSYGARKMTIEEVRRLRWKDTWDFI
LQKNYALN
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacaacaacaatgatggcggtggcggtggcagcgccaacggcaacaccatgcag
cagcgccgcaagacaacgacacgctccagatcaaagcagcagcagcaacaacaatgcacc
agcgaaaacgtaatcgaaaaaaatcaaacgaacggcgcacaaaacgaaagacttcacttt
cgcggaagcagcaaagactcggcgctgtcgacgccgctgctgccgcgcagccgttcaaca
acctcagccatcaactcaccttccccactgtgctgtaacggtggtttgtccatactcaac
tgctgccgcgatgtcaactgccacctgaatgcacctttgcgcggcagcgtggagtcgtcg
cgcagtcggcgttccgagagccggcaatcgtcgctaacagcgacgccgacgacaacgcca
aagcaagcttcaccttcgcctacgatctccgaacgttcacgatcttgttctggatcccgc
tcccgttcgtgctcttgcgacggccgccttgtagattgccataaacacagcgctgcggca
gcagctgcgtctacagccgcaccgcagtttaccgttaacctgagcatcgatctcttcagt
tggactctctttctgctggcattctgcacgcgcttttataagctagcaacgccaccccac
attgtcttcgatgaactgcactacggaaagtacatcgcccactacatgcgcaacattttc
ttcttcgatcagcacccgcccctcgggaaacagctgatcgctggcctcgtcagcctagcc
ggatacgatggcaactacacattctctaggatcggggccgcgtacgcgccggacgtgcca
atcttctggttccgctttatacccgcactgtgcggcagcctcctggcccccgccgtctac
aggctactgctggaggccaggcttcatcgctgggcagcagctctgggcggccttctcgtc
gtcctggacaactctttgctgacccagtcgcggttcgtgctcatggaatcgatgctgctg
ctggccagcacgctcgggatcgcctgtctgctccgcttccagcgctgtcgcttgggcagc
ttccagtggctgtgcaatggatctgcggcaggcgtgctcctggcttgtgcgggcgccgtc
aagtatatcggcttcctggccctggctctggccgggtatctgctctgccgccacctgtgg
caactcctgtacgacgcgagcctaacgaatcgccagctctggatgcacgccctgagtcgg
cttctgctcttcgtgggcattcccatagccgtgtatataggggtattctacgtccacttc
cggacgctgcaccgggcaggccctcatgatagcattatgaccagtgcctttcaggcgtcg
ctggagggcggcctggcctcgatcaccagtggccagccgctggctgtggtccacggctcg
cagataacgctgcgacacacccacggacgcacttgctggctgcactcccacgctgcagtc
tacccggtgcggtacaaggacaagagaggctcctcccaccagcagcaggtcacatgctac
tcattcaaagacgtgaacaactggtggatcgtgaagcggccggagcgggacgacctggtg
gtgggggaacagccagacgtcatacagcacggcgacgtcatccaactggtgcacggaatc
accagtagggcgttaaactcgcacgacgtcgctgctccgatgacgccccagtgccaggag
gtcagctgctacattgactacgaaatcaagatggccggagagctgctgtggcgcgtggag
attctcaatcggaactctgagggcgacagctggcatgccatcaaatcggagatacgtctc
gtccacgagtcgacgggcgctgccctgaagttcagcggacggcagctgccggactggggc
ttcaaccagcacgaggtagtggccgatcgggatcaggtgcacgaagacgccatttggaat
gttgaggagcatcgctacaccaagactcaggatcagcgggaacgagagcgtcagttgctc
tccgccgagatgatacccacgaagcggacaaagctctcgttctgggccaaactcctggag
ctgcagacgaagatgttctggcacggcaagcacctgcaggcgcacatgtacagctcgctg
ccgcacgagtggccgctgatggacaagggcattgcctactggctggactcgcagtccagt
gcccagatttatctcctgggcaacgtactcatttggtacacggccagtgccgggatactg
gtatacgccaccctcctggccttctatgcggtgcgtaggagacggctctgcttcgacgtc
tcccagcacgagtggcagcgcttcctcatggctggcgacaccttcttcgtgggctatatg
atgcactatctgccgtactattttgtggaccgcactctctttctgcacaactatctgccc
gcctttgtcttcaagctgctgttgctgtgctttgtcgtggagcatctggactaccttttg
cgccgacactgctctggccgaggagtgcacttggtgcgcgtctatcgcttggcgctgctc
ctctggctgctcgccgtcggcagtgtgtttgtcaagttcttgccgctcagctacggagca
agaaagatgaccatagaggaggtcagacgcctgcgctggaaggacacctgggactttata
ttgcaaaagaactatgcgctgaactga

DBGET integrated database retrieval system