KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19369Help
Entry
Dpse_GA19369      CDS       T01032                                 

Definition
GA19369 gene product from transcript GA19369-RA (EC:2.3.1.-)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 558 aa AA seqDB search
MKINNKYEFDDDVASICESTAALTEGCRLPVRMHKTDDWPLAEIVSIKELDGRRQFYVHY
VDFNKRLDEWVNEEDLYTRKVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPG
IGISSAGAAGIGSAGAGGGGVGVGVTVGGSVTGSGGANVAGGVVSGAVVSTGGTVGGGEL
VNGNNVLAAALQKRFNRRRRVHGNTHGHHMPSQQPQHPQTPNAQVATPLHVTGDGLIPTA
PIEDGDGSQEGKIPTPRQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQ
MPCIYICEFCLKYCKSRKCLERHLSKCNLRHPPGNEIYRKQTISFFEIDGRKNKVYAQNL
CLLAKLFLDHKTLYYDTDPFLFYIMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPY
QRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPSTEGE
KPTITINDICECTSIKKEDVISTLQNLNLINYYKGQYIVCINRDTIEQHHRAMEKRKIRI
DSKCLHWTPKDWSKRSKW
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaataacaaatacgagttcgacgacgacgtcgcatcaatatgcgagtcgacg
gctgcattgaccgagggctgccgcctgccggtgcgtatgcacaagacggatgactggccc
ttggcagagatcgttagcatcaaggagctggacggtcggcgtcagttttatgtccactat
gtagacttcaacaagcgcctagacgaatgggtcaacgaggaagatctgtacaccagaaag
gtgcagtttccccgtcgcgatggttctcaaactggcaccagcacgggcgtaacaactccg
cagcgccatcactctctggccggtagtgtgtcgcgtcccacttcgccccagcatccgggc
attggaatcagctccgcaggggctgctggcattggcagtgccggtgccggtggtggtggc
gttggcgttggcgttaccgttggcggcagcgtcactggtagtggaggagctaacgttgca
ggaggcgtagtgagcggtgccgtagtgtctacaggtggcaccgtaggcggtggagagttg
gtcaacggcaacaatgtcctggctgctgctctgcagaagcgtttcaataggaggcgcagg
gttcacggcaacacccatggccaccacatgccgtcgcaacagccgcagcatccacaaaca
ccaaacgctcaggttgccacacctttgcatgtgacaggtgatggtctgattcccaccgca
cccattgaagatggcgatgggtcgcaggaaggcaagattcccacgcccaggcagtcgggc
agcatggtcacacaccaggacgatgtggtcactcgcatgaagaacgtggaaatgatcgag
ctgggccgccaccgcattaagccctggtacttctcgccctatccccaggagctctgccag
atgccatgcatctacatctgtgagttctgcctcaagtattgcaagagtcgcaagtgcctg
gagcgtcatctctccaaatgcaatcttcgtcatccgccgggcaatgagatttaccgcaag
cagaccatctccttcttcgaaatcgatggacgcaaaaacaaggtgtacgcacagaatctc
tgcttgctggccaagctgttcttggaccacaagacgctctactacgacacagatccattt
ctgttctacattatgactgaattcgattcgcgcggcttccacattgtcggctatttctca
aaggaaaaggaaagcaccgaggactacaacgtggcctgcatattgacaatgccgccgtat
cagcgcaaaggctatggcaagctgctcatcgagttcagctacgagctgtccaagttcgaa
ggcaagacaggctcgccagagaagccgctgtccgacctgggactgctctcatatcgctca
tattgggcccagacaatactggagatattcattagtcagaatcccagcactgaaggcgag
aagccaactataacgatcaacgacatttgcgagtgtacttcgatcaagaaggaggacgtg
atctcaacattgcaaaaccttaatctcatcaactactataaggggcagtatatagtctgc
atcaatcgtgacaccatcgagcagcatcatcgcgccatggagaaacgcaaaattcgcatc
gactccaagtgcctgcactggacccccaaggattggtccaagcgctccaaatggtaa

DBGET integrated database retrieval system