KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19585Help
Entry
Dpse_GA19585      CDS       T01032                                 

Definition
GA19585 gene product from transcript GA19585-RA (EC:3.5.1.1)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dpse_GA19585
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dpse_GA19585
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dpse_GA19585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 653 aa AA seqDB search
MSANGDSAPTTVPGATKPIDIQVRVPTHERLMSIDKGMAPSSPTLPSPTIRRNKSDGKLM
AQDIKEARVRVIYTGGTIGMMRNERNVLAPIPNALVRSIRKYPNIHDEEYALRRFGASAS
MAPLVLPFVQGMDRRVLYQVTEYTPLLDSSNMTMHDWARIANDIQQSYEFFDGFVVLHGT
DTLSYTASALSFMLENLGKTVIITGSQIPIFETRTDGKDNFTSALIIAGNYVIPEVCIFF
GHKLMRGNRTVKVSSNSLDAFDSPNVPPLARIGIDVNVDYRLIFRPCSIERFCVHLNLDE
NVGLLRIFPSISLSTFRAFLAPPIRGVVLQSFGSGNIPSNRRDLIEELQAAADRGVIIIN
CTQCPNGSVAEIYDTGKVLCDLGVIPGYDMTPEAALSKLAYVIGKEDWSLDVKKQMMQSN
LRGELTSVTAPKMEDYDLVDAVARSLHLSSPQELDQLGATLFPAMINGAVAEGDLKKINN
LKAYGADLSGTNHDQRTALHLACQLGNVEIVKYLLHNGVSVHVRDRYDRTPLLEAVSTDS
HEIIQLLINCGAHLTGSSRAVGEQLCAAAARGSLTRLKSYQYAGADLSQPDPSGRTVLHV
AALHGFPEVVEYVLPYFESASEKDLLGLSALNYAERGGHAALVDLLKAAGCEA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaacggagacagcgctccgacgacggtcccgggagccaccaagcctatcgat
atccaggtacgggtgccaacccacgagcgcctcatgtccatcgacaagggtatggcgccg
tcctcgccgacgctgcccagtcccacgatccggcggaataagagcgacggcaaactaatg
gcccaggacatcaaagaggcacgggtgcgcgtcatctacacgggcggcaccattggcatg
atgcggaacgaacgaaatgtgctggcgcccatacctaatgccctagtgcgcagcattcgc
aagtatccaaacatccacgacgaggagtatgcattgcgacgctttggggcctcggcatcg
atggcgccgctggtcctgccctttgtccaaggaatggacagaagggtcctataccaggtc
accgagtacacgccgctgctggacagcagcaacatgacgatgcacgactgggcccgcatc
gccaatgatatacagcaatcgtacgagttctttgacggcttcgttgtgctgcatggcacc
gacacgctctcgtacacggcctcggccctgtcgtttatgctggagaatctgggcaagacg
gtgatcatcacaggatcacagataccgatctttgagacgcgcaccgacggcaaggacaac
ttcacatccgccctgatcatagccggaaactacgtcataccggaggtgtgcatcttcttc
ggccacaaactgatgcgcggaaatcgcacggtgaaggtcagctccaattcgctggacgca
ttcgattcgccgaatgtgccgccgctggcgagaattggaatcgatgttaatgtggactat
cgtttgatcttccggccctgcagcatcgaacgcttctgtgtccatctgaatctcgacgag
aatgttggcctgctacgaatctttccgagcatttcgctctccacattccgtgccttcctg
gcgcccccgatcaggggggtggtgctgcagtccttcggctctggcaacataccctcgaat
cgccgggacctgatcgaggagctgcaggcggccgccgatcgtggcgtaatcatcataaac
tgcacccagtgtccaaacggctcagtggcggaaatttacgacacgggcaaggtcctgtgc
gatctgggcgtcattcccggctatgacatgacccccgaagcagcactctccaagctggca
tatgtcattggcaaggaggactggtcgctggacgtcaaaaagcagatgatgcagtcgaac
ctgcgcggagagctgacatcggtgacggcccccaagatggaggactacgatttggtggat
gctgtggcgcgctctttgcacttgtcctcgccacaggaactggaccagctgggcgccacc
ctcttcccggccatgatcaatggcgccgtcgccgagggagatctgaagaagatcaataac
ctgaaggcgtacggcgccgacctctccggcaccaatcacgaccaacgaacggccctgcat
ttggcctgccagctaggcaacgtcgagatcgttaagtatctgctgcacaacggagtctcc
gtccacgtacgtgatcgctacgaccgcaccccgctgttggaggccgtctccacggacagt
cacgagatcatccaattgctcatcaactgtggcgcccaccttaccggctcctcacgagcc
gtcggcgagcagctgtgcgcggccgctgcccgcggctcccttacgcgcctcaagtcgtat
cagtacgcgggcgctgatctctcccagccggatccgtcgggacgcacagttctgcatgtg
gcggccctgcacgggttccccgaggtggtggagtacgtgctgccctacttcgagagtgcc
agcgagaaggatttactcggtctaagcgccttgaactatgcagagcgtggcggtcatgca
gcccttgtagatctgctgaaagcggctggatgcgaggcctag

DBGET integrated database retrieval system