KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19618Help
Entry
Dpse_GA19618      CDS       T01032                                 

Definition
GA19618 gene product from transcript GA19618-RA (EC:3.4.21.-)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     Dpse_GA19618
Peptidases [BR:dpo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dpse_GA19618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 274 aa AA seqDB search
MKFLIILALAIASASAFPEPELVSRNRVMPVQDSIEGRITGGSAATTGQFPYQVGLSLKL
SALSSAWCGGSLIGNQWVLTAAHCTDGVQSVTVYLGATVRTSAEVTHTVASSQILIHSGW
NSANLRNDISLIKIPVTSYSTKIQAARIPAIASSYSTYAGDSVIASGWGKISDSATGVTN
NLQWAKLTVITNSVCANTYGTSIVTASNICVSTPNGVSTCNGDSGGPLVLESSKVQVGLT
SFGAAAGCQKGYPAAFTRLTSYLDWIKTNTGISY
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctgatcattctggctttggcgatcgcctccgcttcggctttccccgagccc
gagctggtgtcccgcaaccgcgtgatgcccgtccaggatagcatcgagggtcgcattacc
ggaggatccgctgccaccaccggccagttcccctaccaggtgggactatccctcaagctg
agcgctctctccagcgcctggtgcggtggctctttgatcggcaaccagtgggtgctcact
gctgctcactgcaccgacggtgtccagtccgtgactgtctacctgggtgccaccgttcgt
acctccgctgaggtcacccacaccgtcgccagctcccagatcctcatccactccggctgg
aacagcgccaacctgcgcaacgacatctctctgatcaagatccccgtcacctcgtacagc
accaagatccaggccgccaggatcccagccatcgccagctcctactccacttacgccggt
gactccgtgatcgcctccggctggggcaagatttccgactccgctaccggtgtgaccaac
aacctgcagtgggccaagctgactgtcatcaccaattccgtgtgcgccaacacctacgga
acctccattgttaccgcctccaacatctgtgtgtccacccccaacggtgtgtccacctgc
aacggcgactccggcggccctctggtgctcgagtcctccaaggtccaggttggtcttacc
tccttcggcgctgctgccggctgccagaagggctaccccgctgccttcactcgcctgacc
agctacttggactggatcaagaccaacactggcatctcctactaa

DBGET integrated database retrieval system