KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19622Help
Entry
Dpse_GA19622      CDS       T01032                                 

Definition
GA19622 gene product from transcript GA19622-RB (EC:2.1.1.43)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dpo00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 633 aa AA seqDB search
MATAEAQVNVNRNLQKQDLRNLEVSNLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAI
SGVQTVRFKNELERNITIKLERLSEKKIKLLLKSKHQRHKYDIQQQKLLRILAERRKARA
MTPLAPASVLAPSMETARPRLRSTSLNSLSPSNSSGYGSILGCDDSDQSSQLVLKPNVLK
RRRSNCVQIPTPAAKRSRKNDGTTVKRRPKGEYIVEKIESVEVVQFQPVFFVKWLGYDVS
ANTWESYVNLSDCAEMEKFVERHLQLHQHYIAQITGELDTQLSDIPQTEDLKTISIAEID
AYDPLELQIDFILLAQYRAAASRSQREPERIGARALHRMQVRRSHFARRKQLIDLLLFEH
RMNRVELPSPPIRVENNWDLDTIDSGFKYIQKNIIGEGVPKPQAGLVGCMCRHQSGEQCT
ASSMCCGRMAGEIFAYDRTTGRLRLRPGSAIYECNSRCSCDESCTNRVVQNGRKHPLVLF
KTSNGSGWGVRTPQPLKKGVFVCEYIGEIITCEEANERGKAYDDNGRTYLFDLDYNTSRD
SEYTVDAANFGNISHFINHSCDPNLAVFPCWIEHLNTALPHLVFFTIRPIKAGEELSFDY
IRADNEEVPYENLSTAARVQCRCGAANCRKVLF
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggccacggctgaagctcaagtcaatgtgaatcggaatttgcaaaagcaggaccttagg
aatttggaagtcagcaaccttacacctctgtcgcccgaggtgatctcgcgccaggcgacc
atcaacatcggcacaatcggacatgtagcacacggaaagtccaccgtagtcaaagccata
tccggcgtgcagacggtccgctttaaaaacgaattggagcgcaacattacaattaagctc
gaacgcttaagcgaaaagaaaatcaagctacttttgaaatccaaacaccagcgacacaaa
tacgatatccagcagcaaaagctgctacggattctcgccgagcggcgaaaggccagggca
atgacaccccttgcccccgcttcagtgctagccccatccatggaaacagctcgtccgcgt
cttcgcagcaccagcctaaactcattaagtcccagcaacagcagcggctatggcagcatc
ctcggctgcgatgatagcgatcaatcatcacagctggtcctgaaaccgaatgttcttaag
cgacgacgtagcaactgtgtccagatacccactccagcagccaaaaggagcaggaaaaac
gatggaacgactgtgaagaggcgacccaagggcgagtacattgtggagaaaatcgagagc
gtggaggtggtccagtttcagcccgttttctttgtgaaatggctgggatacgatgtcagc
gcgaacacatgggaatcgtacgtaaatctatccgattgtgccgaaatggaaaaatttgtt
gagcgtcatctacagctgcatcagcattatatagcccagatcacgggtgaactggatacg
cagttgtcggacataccgcagacggaagatcttaagactattagcattgcagagattgat
gcctatgatccgctcgagttgcagattgattttatactgctagcgcaataccgtgccgct
gccagccgcagccagcgggaacccgagcgaatcggtgcgcgggccctgcaccgcatgcag
gtcaggcggtctcactttgcacggcgcaagcagctgattgatttattgctgtttgagcac
cgaatgaatcgagtcgagctgccgtcgccgcccatacgagtggagaacaattgggatctg
gacacgattgacagcggcttcaagtacatacaaaagaacataattggagaaggggtaccc
aagccgcaagctggacttgtgggttgtatgtgccgccaccagagcggagaacaatgcacc
gcctcctccatgtgttgtggaagaatggctggtgaaatctttgcctacgatcgtaccacg
ggacgtttgcggctccggccgggcagtgccatctatgagtgcaacagtcgatgctcctgc
gacgagagttgcacgaatcgtgtggtacagaatggacgaaagcatccgcttgtgctcttt
aaaaccagcaatggcagtggttggggtgtccgcacaccgcagccattgaagaagggagtg
tttgtctgcgaatatatcggcgagatcattacgtgcgaggaggctaatgagcgtggcaag
gcctatgacgataatgggcgtacctatctgtttgatctggactacaatacatcgcgggat
agcgagtatacggtggacgcggccaactttggcaatatatcgcattttatcaatcattcg
tgtgatcccaatctggccgtgttcccatgctggatcgagcacttaaatacggccctgcca
catctggtcttctttaccattcgcccgattaaggcgggggaggagctcagttttgactac
attcgggcggacaacgaggaggtgccatatgagaatctatcgacggctgcgcgtgtccag
tgtcggtgtggggcggccaattgccggaaggtcctattttaa

DBGET integrated database retrieval system