KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA19749Help
Entry
Dpse_GA19749      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00040  Pentose and glucuronate interconversions
dpo00053  Ascorbate and aldarate metabolism
dpo00830  Retinol metabolism
dpo00860  Porphyrin and chlorophyll metabolism
dpo00980  Metabolism of xenobiotics by cytochrome P450
dpo00982  Drug metabolism - cytochrome P450
dpo00983  Drug metabolism - other enzymes
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dpse_GA19749
   00053 Ascorbate and aldarate metabolism
    Dpse_GA19749
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dpse_GA19749
   00860 Porphyrin and chlorophyll metabolism
    Dpse_GA19749
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dpse_GA19749
   00982 Drug metabolism - cytochrome P450
    Dpse_GA19749
   00983 Drug metabolism - other enzymes
    Dpse_GA19749
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dpse_GA19749
Glycosyltransferases [BR:dpo01003]
 Others
  Hydrophobic molecule
   Dpse_GA19749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_1_3
Motif
Other DBs
NCBI-GeneID: 4803130
NCBI-ProteinID: XP_001359923
FlyBase: FBgn0079745
UniProt: Q293Y5
Position
2
AA seq 533 aa AA seqDB search
MRTPCCLLALGLGLFLLLSAGAADERVQSSKILAVFPFTGRSQYIFAEQYLKELARRGHN
VTVINTFGSDKNEPNFRVIGATKIHELMAAFAAAGFSQPAGQWKMLSMTTEFLNMLTANV
LEDAAVKALLESRETFDLLIMETVQNEALFGLGQHFGALTIGISSYGTDRHIDELMGNIS
PLSYNPMLLSSRTEQMSYEERLWNVWEAAVVWLHKRLVHLPTQRQLYGKYFPQAQQSLEQ
VMDSFSLMLLGQHFSLSYPRPYLPNMIEVGGLHLEQQRTVQPLPADIAEFVEQSPHGVIY
FSMGSNIKSADLPPSTRKVLMEALGALPQRVLWKFEADQLEDKPENVFISKWFPQPDILA
HPNVKLFITHGGLLSTIESIFFGKPVLGLPVFYDQHLNVQRAKQAGYGLAADLWGSNSTE
LQSLIHELLDNPSYAEAAQIKSKLYRDQKETALERAVWWTEYVLRHEGAAHLRCASRQLN
FVQLHGLDTWGVLGAVAVLSLLVILFVLKLLIEALCYVISKRRRGTENKLKEQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagaactccctgctgtttgctggccctgggcctggggctgtttctgctgctcagtgcg
ggggcggctgatgagagggtccaaagctcaaagattttggccgtatttccatttactggc
cgatcgcagtacatattcgccgagcagtatctcaaggagctggcgcgacgaggtcataat
gtgacggtaatcaacacttttggcagcgataaaaacgagcccaactttcgtgtgattggt
gccacaaagatacacgaattgatggcagcctttgctgctgctggtttcagccagccggct
gggcagtggaaaatgctgtccatgaccacggaattcctcaacatgctcaccgccaatgtc
ctggaggatgcggctgtcaaggccctgctggagagccgtgagacctttgatctgctgatc
atggagacggtgcagaacgaggccctgtttggtttgggccagcacttcggcgccctcacc
attggcatctcatcgtacggcaccgatcgacacatcgacgagctgatgggcaatatatca
cctctgtcctacaatcccatgctgctgtcatcgcgcaccgagcagatgagctacgaggag
cggctgtggaatgtgtgggaggctgctgtcgtgtggctgcacaagcgattggttcatctg
cccacccagaggcagctctacgggaagtacttcccccaggcccagcagtcgttggagcag
gtcatggacagcttctcgctgatgctgctgggccaacacttcagcttgagctatccccga
ccctatctgcccaacatgatcgaggtgggaggtctccacctcgaacagcagcgaacggtg
cagcccctgcccgctgacattgccgaatttgtggagcagtccccccacggcgtcatctac
ttctccatgggatcgaacatcaagagtgccgacctgccgccctcgacacgcaaggtcctg
atggaggccctgggcgccctgccgcagcgagtgctgtggaaattcgaggcggatcaactg
gaggacaagccggagaatgtgttcatcagcaagtggttcccccagccggatattctggcc
catcccaatgtgaagctgttcatcacccacgggggcctgctcagcaccatcgagagcatc
ttcttcggcaagcccgtactgggtctacccgtgttctacgaccagcatctgaatgtgcag
cgggccaagcaggcgggctacggcctggctgccgatctctggggcagcaacagcacggag
ctgcagtctctgatccacgagctgctcgacaatccctcgtacgcggaggcggcgcagatc
aagtccaagctgtatcgcgatcagaaggagactgccttggagcgtgccgtctggtggacg
gagtacgtgctgcgtcacgagggcgccgcacacttgagatgcgcctcacgacagttgaac
tttgtccagctccacggcttggatacatggggtgtgcttggggctgtcgctgttctatca
ctgctcgtcattttgtttgtgcttaagcttttaatagaagctttgtgttatgtcatttcc
aaacgtcgtcgtgggacagagaacaaattaaaggaacagtag

DBGET integrated database retrieval system