KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20009Help
Entry
Dpse_GA20009      CDS       T01032                                 

Definition
GA20009 gene product from transcript GA20009-RA (EC:5.-.-.-)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dpse_GA20009
Enzymes [BR:dpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dpse_GA20009
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Dpse_GA20009
  Exosomal proteins of colorectal cancer cells
   Dpse_GA20009
  Exosomal proteins of bladder cancer cells
   Dpse_GA20009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 493 aa AA seqDB search
MKFLICTLLAAAFYVAAAEVKVEEGVLIATVDNFKQLVADNEFVLVEFYAPWCGHCKALA
PEYAKAAQQLAEKDSPIKLAKVDATVEGELAEQYQVRGYPTLKFFRSGAPVEYSGGRQAA
DIISWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDTDSEEAKTFTKAANALDSFV
FGVSSNADIIAKYEAKDNGVILFKPFDDKKSVFEGELTEETLKKFAQVQSLPLIVDFNHE
SASKIFGGSIKSHLLFFVSKEAGHIEAHVDPLKEIAKKYRDDILFVTISSDEEDHTRIFE
FFGMNKEEVPTIRLIKLEEDMAKYKPESNDLSAETIEAFLKKFLDGKLKQHLLSQDLPED
WDKQPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNTDIVIA
KMDSTANELENIKISSFPTIKYFRKDDNKVIDYNLDRTLDDFIKFLDANGEVADAEPAEE
TEEEEEAPKKDEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctaatctgtacactactcgccgcggctttctacgtggccgctgccgaagtc
aaagttgaggagggggttctcattgcgacagtggacaactttaagcaattggttgccgac
aatgaatttgtgctagttgagttctatgctccctggtgcggacactgcaaggccctcgct
cccgagtatgccaaggctgctcagcagctggccgagaaggactcgccaatcaagctggcc
aaggtcgacgccaccgtcgaaggtgagctagctgagcagtaccaggtgcgtggttatccc
acactcaagttcttccggagcggtgctccagtggagtacagcgggggtcgtcaggccgcc
gacatcatctcttgggtaaccaagaagactggaccacctgccaaggatctgaccagcgtg
gccgatgctgagcagttcctcaaggacaacgaaattgccatcattggtttcttcaaggat
accgactctgaggaggccaagaccttcaccaaggccgccaacgccctggactcgtttgtc
tttggagtgagcagcaatgccgatattattgccaagtacgaggccaaggacaatggcgtg
atcctgttcaagcccttcgatgacaagaaatctgtgttcgaaggcgagctcaccgaggag
actctgaagaagttcgctcaagtacagtctctgcccctgattgtggacttcaaccacgag
tcggcttcaaagatcttcggaggctccatcaaatcccacctgttgttcttcgtctccaag
gaggccggacacattgaggcccatgtcgatccccttaaggagattgctaagaagtaccgc
gatgatattctgttcgttacgatctcgtctgatgaggaagaccatacccgcatctttgag
ttcttcggtatgaacaaagaggaggtgccaaccatccgtctgatcaaactggaggaggac
atggccaagtacaagccagagtcgaacgatctgtctgccgagaccattgaagctttcctg
aagaagttcctcgacggaaaactgaagcagcacttgctgtcccaggatctgcccgaggat
tgggataaacagcccgtcaaggtccttgtctccagcaacttcgagagcgtcgccctcgac
aagagcaagtccgtcctggttgagttctatgctccatggtgcggccactgcaagcagctg
gcacccatctatgaccagctggccgagaagtacaaggacaacaccgacattgtgattgcc
aagatggactctactgccaacgagctggagaacattaaaatctcatccttccccacaatc
aagtacttccgtaaggatgacaacaaggtcatcgactacaacttggatagaactctggac
gatttcatcaagttcctcgatgccaacggtgaggtggccgatgccgagcccgcagaggag
accgaggaggaggaggaggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system