KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20153Help
Entry
Dpse_GA20153      CDS       T01032                                 

Gene name
Dpse_Uro
Definition
GA20153 gene product from transcript GA20153-RA (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dpo00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:dpo00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 346 aa AA seqDB search
MFATPLRQPTNASGARPAVSMDGQETPFQYEITDHGYGKDAVKVLHVSRKGPVHTIQEFE
VGTHLKLYSKKDYYQGNNSDIVATDSQKNTVYLLAKKYGIESPEKFALMLGQHFLNKYSH
VEEAHVHVETYPWQRVCQEETKSVNNQGQGSCNNFTSIDNRSLHNHAFIFTPTALHYCDV
VIRRTDPKQTVITGIKGLRVLKTTQSSFVNFVNDEFRSLPDQYDRIFSTVVDCSWEYSDT
ETVNFSRAWQTVKNIILRNFAGDPQVGVSSPSVQHTLYLSEKQVLDVIPQVSVISMTMPN
KHYFNFDTKPFQKIVPGDNNEVFIPVDKPHGTIYAQLARKNISSHL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccacgcccctaagacagcccaccaatgccagcggtgctaggccagcagtctca
atggatggtcaggagacgccgtttcagtacgagatcaccgatcacggctacggcaaggat
gctgtaaaggtgctgcacgtaagcaggaagggacccgtgcacaccatccaggagttcgag
gtgggcactcacctgaagctgtacagcaagaaggactactaccagggcaacaactcggac
atcgtggccaccgactcgcagaagaacaccgtctacctgttggccaagaagtatggcatc
gagagtcccgagaagtttgctctgatgctggggcagcacttcctcaacaagtactcgcat
gtggaggaggcccacgtccatgtggagacctatccctggcagcgtgtctgccaggaggag
acaaagtctgtcaataatcagggtcagggcagctgcaacaacttcacttccattgacaat
cgctcgctgcacaaccacgccttcatctttacgcccacggcgttgcactactgcgatgtg
gtaatccgtaggacagatcccaagcaaactgtcatcactggcatcaagggccttcgcgtc
ctgaagaccactcaatcctcgttcgtcaactttgtcaacgatgagtttcgctcgctgccg
gaccaatatgatcgcatcttcagcactgtagtggactgctcctgggagtactcggacaca
gagacggtcaacttttcgcgtgcctggcaaacggtgaagaatatcatcttgaggaacttt
gccggcgatccacaggtgggcgtctcctcgccctccgtccagcacaccctgtacctgagc
gagaagcaggtgctggatgtgattccgcaggtgtcggtcatctccatgaccatgccgaac
aagcattatttcaacttcgatacgaagcctttccagaagattgtacctggggacaataat
gaggttttcatcccggtggacaagccgcatggcaccatctatgcccagctggcccgcaag
aacatcagtagccatctataa

DBGET integrated database retrieval system