KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20290Help
Entry
Dpse_GA20290      CDS       T01032                                 

Definition
GA20290 gene product from transcript GA20290-RA (EC:2.3.2.13)
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Dpse_GA20290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 774 aa AA seqDB search
MGQKLSYCKKCKDWWKKSDQDETKPRVRNVNANYLAGAPGRDTTDAANSAVLGVLRVDLC
QEDNHNEHHTSHFYAAAAKEALIVRRGEPFRLRIHFNRDYSPSKDAINFVFSVADDKNPR
PGHGTLTALVPHDGIDDLGDTLEWGAGIETHEGTLLTVLIKPPSTCPVTEWRLDIDTKLL
GDGSRSYPVPLPIYVLFNPWCPEDQVYLEDREQRKEYVMHDTTLIWRGSYNRLRPSVWKI
GQFERHVLECSLKVLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWSEDFSGG
VAPTKWTGSPEILQQFHKTQKSVKFAQCWNFSGVLATIARSLGIPARIVTCYSSAHDTQA
SLTVDVFIDANNKKLDAETTDSIWNYHVWNELWMQRPDLGVGQHGAYDGWQVVDATPQEA
SDNMYRVGPASVLAVKHGEILRPFDGGFVFAEVNADKLYWRYNGPSQPLKLLRKDTLAIG
HLISTKAVLKWDREDITDSYKHAERSEEERSTMLKALKQSRHAFSRYYLNDNFNEVEFDM
ELKDDIKIGENFSVVLKVTNKSAEKSHLATGQVNCDAVLYTGVGAMEVKSIGFELELEPK
ASEYVRMEVIFEEYFEKLSSQAAFQISASARVKDTDYEYYAQDDFRVRKPDIKFQMGEGS
IVSRKEIDVIVRLVNPLPIPLHKGLFTVEGPGIEQPLKFKITEIPVGGTAAATFKYVPPY
AGRGTLLAKFTSKELDDVDGYKHYEIEPRPEDLLQPNGSHRSSNIIRRRTDVIA
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgggacagaaactgtcgtactgcaaaaagtgtaaggattggtggaagaagagtgatcag
gatgagaccaagcctcgtgtacgcaatgtcaatgccaactacttggcaggagctcccggt
cgagatacaacggatgcggctaattcggcggttctcggtgtgcttcgagtggatctctgc
caggaggataaccacaacgagcaccacacaagccacttctatgcggcggcggccaaggaa
gctctcatcgtgcgccgcggagaacccttccgcctgcgcattcacttcaaccgcgactac
agccccagcaaggatgccatcaactttgtcttcagcgtggccgatgacaagaatcccagg
ccaggacatggcacactgactgctctggtgccccacgatggcatcgacgatctgggcgac
accctggaatggggagctggaattgagacgcacgagggtacgctcctgacggtgctgatc
aaaccgccctcgacttgtccggtgacagagtggcgtctggatatcgacaccaagctgctg
ggtgatggctcccgcagctatcccgttccgctgcccatctacgtgctgttcaatccgtgg
tgcccggaggatcaggtgtatctggaggatcgcgagcagcgcaaagagtacgtgatgcac
gacacgaccctcatctggagaggctcctacaaccggctgcgtccctcggtgtggaagatt
ggccagttcgagcggcatgttctcgaatgcagcctgaaggttctcggcaccgtgggcagg
atcccacccgcctacaggggcgatcctgtgcgggtggcccgtgccctgtccgcgctggta
aactctgtggatgatgatggtgtgctgctgggcaattggtcggaagatttctcgggcggc
gtggcgcccactaagtggacgggctccccggagatcttgcagcagttccacaagacccag
aagtccgtgaagttcgcccagtgctggaacttcagtggcgtcctggccactattgcccgc
agtctgggcataccagcccgcatcgtgacttgctactcttctgctcatgacacccaggcc
tcgctcaccgtggacgtcttcatcgatgccaacaacaagaagctggacgcggagaccacc
gactccatctggaactaccatgtgtggaacgagctgtggatgcagcgtcccgatctgggc
gtgggccagcatggcgcctacgatggctggcaggttgtggatgccacgccccaggaggca
tcggacaacatgtaccgtgtgggcccagcctccgtgctggcggtgaagcatggcgagatc
ctcagacccttcgacggtggcttcgtttttgcggaggtcaatgcggacaagctctactgg
cggtacaacggtcccagtcagccgctgaagctgctgcgaaaggacaccctggccattgga
catctgatcagcaccaaggcggtcctcaagtgggatcgggaggacatcacggatagctac
aagcatgcggagcggtccgaggaggagcgtagcaccatgctgaaagccctgaagcaatca
cggcatgccttcagtcggtactaccttaacgacaacttcaacgaggtagagttcgatatg
gagctaaaggacgacatcaagatcggcgaaaactttagcgttgtcctaaaggtgaccaat
aagagtgcggaaaagagtcatctggccaccggtcaagtcaactgcgatgcggtgctttac
acgggcgtgggagccatggaggttaaatccatcggctttgaactggagctggagccaaag
gccagcgaatacgtccgcatggaggtcatcttcgaggagtactttgagaaactctcttcc
caggcggcctttcagatctccgcctctgcgcgagtgaaggatacagactacgagtattat
gcccaggatgatttccgagtccgcaagccggacatcaagttccagatgggtgagggcagc
attgtgtcccgtaaagagattgatgtcattgtgcgcctggtcaatccactgccaataccc
ttgcacaaggggctcttcaccgtcgagggtcctggcatagagcagccactgaagtttaag
attaccgagatacctgttgggggaacagctgcagccacatttaagtatgtcccaccgtat
gccggtcgtggcacacttcttgccaagtttacctccaaggaactggacgatgtggatggc
tataagcactacgagatcgagccccgtcccgaggatctgctccagcccaacggcagccat
agaagtagcaacatcatccgacgacgcacagatgttatagcataa

DBGET integrated database retrieval system