KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20318Help
Entry
Dpse_GA20318      CDS       T01032                                 

Definition
GA20318 gene product from transcript GA20318-RA
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Dpse_GA20318
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dpse_GA20318
Transcription factors [BR:dpo03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dpse_GA20318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 1037 aa AA seqDB search
MDDESDDKDDTKRKSRNLSEKKRRDQFNSLVCDLSTLISTSGRKMDKSTVLKSTISFLRN
HNEAADRSKVFEIQQDWKPTFLSNDEFTHLMLESLDGFMIVFSSLGAIFYASESITSQLG
YLPQDLYRMNIYDLAYEMDHEALMNVFVNPPPVIEPRQTEISASNEISFYSHIRRGGVEK
ADTNSYELVKFVGYFRNDPNTSAGSRSASPSGSQSAPVLPRIFRENTSVEVDRKLVFVGT
GRVQNPQLIREMSIIDPTSNEFTSKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSGYDYYH
VDDLDNIVACHEELRQTGEGKSCYYRFLTKGQQWIWLQTDYFVSYHQFNTKPDYVVCTHN
VVSYAEVIKHTQKERQQASSKDCKAQTSMASSSKPATATTTLRDLELANENLESNLLDNS
LSKLTNETAATSPAVESSPMWSATVTVAAAAASGSCHANPLKIARPASSYSNISSTGISP
KAKRKCYFYNNRGNDSDSTSMSTESGTSRQSGASRHSVLTHASSQSQRQRSQLRDHSQSH
NNNHHQQQQQQQHQQQQQQAQQQQQQQHLQHLQQQQQQIQQQLQQNVGPPKLVPMLPIGP
AQIMAGNAFPQSPYPLASPQLVAPTFLEPQQFLAAIPMQPVIGPFPVPPVPVLSPLAVPS
QGQGQQELLPGSVVMTPTQSQLQDQLQRKHDELQKLIMQQQDELRIVSEQLLLARYTYFQ
PVVQMGLSPGNMAPGNMTPASMTPGAAMPNAAGGNVQQRAFNFSSTNAVQPHFNQYGFAL
NSEQMQNQQDQQMMMQQQQNLHSQQQHNLHQQHQNQNQMQQQQHLLEQQQLQLQQQQQNE
MLSREDIEDIDAFLNLSPLQSLEPPAALNPSHNNNHSSFNNGNGNSSQNIIGHNNNNSNS
NNNNSSSTAPQNHNEDSLLSYMQMATSPSVNFHMGISDDSETQSEDKMRMGSSSSHLQLQ
QQHLLQQQQQQQQQQQQQQHQQQLPESSSFYHSNPFVAHLQNQNQLPNDLEILPFQMSQE
QSQNLFDASNTAPGGSQ
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgagagcgatgacaaggatgatacgaaaagaaagtcacggaatctgagcgag
aaaaagcgacgggatcagttcaactctttggtgtgcgatctgagcaccctgatatccacc
tccggtcggaagatggacaagtcgacggtcctcaagtcaaccatatcattcctgaggaat
cataatgaggccgcggaccgatccaaggtttttgagatacaacaagactggaagcccacg
tttctgagcaacgacgagttcacgcacctgatgctggagtccctcgatggtttcatgata
gtctttagcagcttgggtgctatattctatgcctcggaaagtattacctcacagctgggc
tatttgccgcaagacctgtacagaatgaacatctacgatctggcctatgaaatggaccac
gaggccctcatgaacgtcttcgtcaatccgccgcccgtgatcgagccccggcagacggaa
atcagtgccagcaacgagatatccttctacagccatataaggcgcggcggggtcgagaag
gcggataccaactcctacgaactggttaaatttgtgggttactttcgtaacgatcccaac
acctcggcgggctcccgttccgcaagtccgagcggcagccagtctgcgcccgtcctgccg
cgcatcttccgtgagaacaccagcgtggaggtggacagaaagctggtatttgtgggcacg
ggccgcgtccagaacccgcagctgatacgcgagatgagcataatcgacccaaccagcaac
gagtttacttcgaagcacagcatggagtggaagttcctgtttctcgatcaccgcgcgccc
ccaatcattggctacatgccgttcgaggtgctgggcacctccggatacgattactatcac
gtcgacgacttggacaacattgtggcgtgccacgaagagttgcgacaaacgggcgaggga
aaatcctgctattaccgcttccttaccaagggccagcaatggatatggctgcaaacggac
tactttgtaagctatcatcaattcaacacgaagccggactacgttgtgtgcacccacaat
gttgtcagctatgcggaggtcatcaagcacactcaaaaggagcgccagcaggcgagcagc
aaggactgcaaggcccagacctcgatggccagcagcagcaagccggcgacggctacgaca
acgctgagagacttggagctggccaatgagaatctggagagtaatctgctggacaatagc
ctatcgaaattgaccaatgaaacggctgccacctcacccgcagtggagtcgtcacccatg
tggtcagcgacggtgacggtagcggcagcggcagcatcgggctcttgccacgcaaatcct
ctgaaaatagccaggcccgcctcgagctatagcaacattagctctacgggtatctcgcca
aaagccaagcggaaatgttacttctacaacaacagaggcaatgattcggattccacttca
atgtctacggaatcaggcaccagcagacagtcgggagccagcaggcactccgtgttgacg
catgcgagttcgcaaagtcaacgacagcggtcacagcttcgtgatcacagtcaaagtcat
aataataaccatcaccagcagcagcagcagcaacagcaccaacaacaacaacagcaggcg
caacaacagcagcagcaacaacatctgcaacacctccagcaacagcagcagcagatccaa
cagcagctgcaacagaacgtggggccgcccaagctggtgcccatgcttcctatcggaccc
gcacagatcatggcaggcaacgcgtttccgcagtccccctatcctctggccagcccccag
ctggtggcgcctacttttctggaaccgcagcagttcctggcagccatacccatgcagcca
gtgatagggccgttccctgtgccgccagtccctgtcctctcgccgctggctgtgccgagt
caagggcaagggcagcaggaactactgcccggaagtgtggtgatgacgccgacgcaaagt
cagctgcaggatcagctgcagcgcaaacacgacgagctgcagaagctgataatgcagcaa
caggacgagctgcggattgtgtccgagcagctgctcctagcccgctatacgtacttccag
cccgtggtgcagatgggactctcaccgggcaacatggcaccgggcaacatgacaccggcc
agcatgacaccgggagctgcgatgcccaatgcggcgggtggcaacgttcagcagcgcgca
ttcaacttctcaagcacgaatgctgtgcagccgcatttcaatcagtatggattcgcgctg
aactcggagcagatgcagaaccagcaggaccaacagatgatgatgcaacagcagcagaac
cttcacagtcagcagcagcataatctccatcagcagcatcagaatcagaatcaaatgcag
cagcagcaacatcttttggagcagcagcaattgcagctgcaacagcagcagcagaacgaa
atgttgtcgcgcgaggacattgaggacattgatgcctttctcaatctgtcgccgctgcaa
tcgctcgagcctccagctgcactaaaccctagccacaacaacaaccattccagctttaac
aatggcaacggcaacagcagtcagaacatcatcggccacaacaacaacaacagcaacagc
aacaacaacaacagcagctcgactgccccacagaatcacaacgaagactccttgttgtcg
tatatgcagatggccacaagcccttcggtcaacttccacatgggcatcagtgacgattcc
gagacgcagagtgaagacaaaatgaggatgggcagcagcagtagccatctgcagctgcag
cagcaacatctcctgcagcaacagcaacagcagcagcagcaacagcagcaacaacaacac
cagcaacagctaccagagtcgagcagtttttaccattcgaatccattcgtcgcccaccta
cagaatcagaatcaattgccaaacgacctggaaatattgccctttcaaatgtcgcaagag
caatcacagaatctattcgatgcatcaaacacagcccctggcggaagtcaataa

DBGET integrated database retrieval system