KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20320Help
Entry
Dpse_GA20320      CDS       T01032                                 

Definition
GA20320 gene product from transcript GA20320-RA (EC:2.7.11.24)
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dpo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 365 aa AA seqDB search
MSRKMPKFYKLDINRTEWEIPETYQSLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQ
SAVHAKRTYRELRLLKHMEHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNII
RTQKLSDDHVQFLIYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAES
EMTGYVATRWYRAPEIMLNWMHYNKTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIME
VLGTPAEEFMSRISSESARNYIRSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDADQRI
TAEQALAHPYMEKYHDPTDEQTAALYDQSFEENELPVEKWREMVFTEVQAFRPTQAFAEL
LPKDL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaaaaatgccgaagttctacaagctagacataaatcgcacggagtgggagata
ccagagacataccaaagccttcagcccgtcgggcagggggcctacggtcaggtgtgcaag
gctgttgtccgaggaaccagcacaaaggtagcgataaagaaactggcgcggccctttcag
tcggccgtgcatgccaagcgaacgtaccgtgagctgcgcctactgaagcacatggagcac
gagaatgtaattggtctcctggacgttttccatcccggacagcccgccgactcgctggac
cagtttcagcaggtctacatggtgacgcatctcatggacgcggacctcaacaacataata
cgcacgcagaagttgtctgacgaccacgttcagttcctgatataccaaatcctaagaggc
ttaaagtatattcacagtgccggggtgatacatcgcgatttgaaaccgtccaacatcgcg
gtgaacgaggattgcgagttgcgcatcttggatttcggtctggcacgacccgcagaaagc
gagatgactggctatgtggccacgagatggtatcgggcaccggaaatcatgctcaactgg
atgcactacaacaagacggtggacatttggtctgtgggatgcatcatggccgagctcttg
accggacgcaccctcttccccggcaccgatcacattcatcagctgaacctgatcatggaa
gtgctgggcacgccggcggaggagtttatgagccgcatctcctcggagagtgccagaaac
tacatacggtcgttgccagtgatgccgagacgaaactttcgagacatctttcgtggggcc
aatccgctggcgatcgacctgctggagaagatgctcgagctagatgccgaccagcgcatc
acagccgagcaggcgttggcccatccctatatggagaagtaccatgaccccaccgacgag
cagacagcggccttgtacgaccagagcttcgaggagaacgagttgcccgtggagaagtgg
agggaaatggtgttcaccgaggtgcaagccttcaggcccactcaggccttcgccgagctc
ctgccgaaggatttataa

DBGET integrated database retrieval system