KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20377Help
Entry
Dpse_GA20377      CDS       T01032                                 

Definition
GA20377 gene product from transcript GA20377-RA (EC:1.2.1.41 2.7.2.11)
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dpo01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dpo00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 777 aa AA seqDB search
MLRNSFSVAHALRNSFSSNVWRAASSHGPRQPLVSPDRRLEMAHPTFTERSQLKYARRLV
VKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREVMMVTSGAVAFGKQKLAQELLMS
LSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKIAQVLVTKPDFYN
EETRNNLFCTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARRGIPIKDNDSLSAML
AAEVQADLLILMSDVDGIYNKPPWEDGAKLMHTYNSNDSSSIEFGKKSKVGTGGMDSKVK
AATWALDRGVSVVICNGMQEKAIKTIIGGRKVGTFFTEATENTNTVSVEVMAENARTGSR
QMQALTPAQRASAVNTLADLLVSREKFILEANAKDLAEAQKNGLAKPLLSRLSLNSAKLK
NLAIGLKQIAEDSHKNVGRVLRRTRLAEGLELKQVTVPIGVLLVIFESRPDSLPQVAALA
MASGNGLLLKGGKEAAHSNRALMDLVTEALVTVGAEHAVSLVSTREEISDLLSMEKHIDL
IIPRGSSELVRSIQQQSVHIPVLGHAEGVCHVYIDRDADLQKALHIARDAKCDYPAACNA
METLLIHEDLMSGDIFSDVCNMLKREGVKINAGPRLNQQLTFGPPAAKSLRHEYGALECC
IEIVPSLEEAINHIHTFGSGHTDVIVTENDAAAKQFLGSVDSACVFHNASSRFADGFRFG
LGAEVGISTARIHARGPVGVEGLLTTKWILNGQDHAAADFAEGGQRTWLHESMPLDN
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaacagcttcagtgtggcacatgccctgcgcaacagcttctccagcaatgtc
tggcgtgccgccagctcccatggaccccggcagccactggtgtcccccgacagacgcctg
gagatggcccatcccacgttcacggagcgcagccagctgaagtacgcccgccgcctggtg
gtcaagctgggcagcgcggtcatcactcgggaggataaccacggcctggccctgggccga
ctggcctccattgttgagcaggtggccgagtgccatttggagggccgcgaggtgatgatg
gtcacgagtggagcggtggcctttggcaagcagaagctcgcccaggagctgctcatgtcg
ctgtcaatgcgcgagactctcaaccccaaggacagcaaggagttcgatggcgccaccctg
gaaccacgtgcagcggctgcggtgggtcaatcgggcttgatgtccctctacgatgcaatg
tttgcccagtacggcgtcaagattgcacaggtgctggtgaccaagccggacttctacaac
gaggagacgcgcaacaatctcttctgcacactctccgaattaattagcctgaatattgtg
cccatcataaatacgaatgacgccgtgtcgccgccgatgttcatacgtgacgatgagcct
gcgggaggagcgaggcggggaattcccattaaggacaacgatagcttgtcggccatgctg
gccgccgaagtgcaggcggatctgctaatcctcatgtcggacgtcgatggcatttacaac
aagcccccctgggaggatggcgccaagctgatgcacacctacaacagcaacgacagcagc
agcatcgagttcggcaagaagtcgaaggtgggaactggcggcatggactcgaaggtgaag
gcagccacttgggcactggatcgtggcgtcagcgtggtcatctgcaacggcatgcaggag
aaggcaatcaagaccatcattggcggcaggaaggtgggcaccttcttcacggaggccacc
gagaacaccaatactgtgtccgttgaggtgatggccgagaacgctcgcaccggaagccgt
cagatgcaggccctgacgcccgcccagagagccagcgccgtcaacacgctggccgatctg
ctggtgagccgggagaagttcatcctggaggccaatgccaaggatctggccgaggcccag
aagaacggcctggccaagccgctgctctcgcgactctccctcaactcagccaagctgaag
aacctggccattggcctcaagcaaatcgccgaggacagccacaagaatgtgggtcgcgtc
ctgcgccgcacccgcctggccgaaggactggaactgaagcaggtcaccgttcccattggc
gtcctcctggtaatcttcgaatcgcgtcccgactcgctgccccaagtcgccgccctggcc
atggcctccggcaacgggctgctgctcaagggcggcaaggaggcggcccacagcaacagg
gcgctcatggacctggtcacggaggcactggtcacagtgggagccgagcatgccgtctcc
ttggtttccacgcgcgaggagattagcgatctgctgtcaatggagaagcacattgatctg
attattccacgcggctcctctgagctagtgcgcagcatacagcagcagtcggtgcacatc
cccgtcctgggccatgcggagggcgtctgccacgtgtacatcgaccgggatgcggacctg
cagaaggccctgcacatcgcccgcgacgccaagtgtgactatccagccgcctgcaacgca
atggaaaccctgctcatacacgaggatctgatgagtggcgacatcttcagtgatgtctgc
aacatgctgaagcgcgagggtgtcaaaatcaatgccggcccccgtctaaaccagcagctg
accttcggcccgcccgcggccaagagcctgcggcacgagtacggcgccctcgagtgctgc
atcgagattgtgcccagcctggaggaggccattaatcacatccatacattcggcagcggc
cacaccgatgtcattgtaacggaaaacgatgccgcggccaagcaattcctcggcagcgtg
gacagcgcctgtgtgttccacaatgccagctcccggttcgcggacggcttccgcttcggc
cttggcgccgaggtgggcatctccacggcccgcatccatgcccgcggccccgtgggcgtt
gaggggctgctgaccaccaagtggatactgaatggccaggatcatgcagcggcggacttt
gcagagggcggccagcgcacgtggctgcacgagagcatgcccctggacaactag

DBGET integrated database retrieval system