KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20501Help
Entry
Dpse_GA20501      CDS       T01032                                 

Definition
GA20501 gene product from transcript GA20501-RA (EC:2.7.11.-)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dpse_GA20501
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Dpse_GA20501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 648 aa AA seqDB search
MTTPVPRRIKDLLALGIDSDTDDDYNTPLKPHRSNIAAAKNPRPAAAASAFGQRSVIGFN
NAGNKENIPLHNRAAGEVLPRRVSEMAMMDSDSDEEDDNKNDHNLNCAILNDSFVLSPTH
ELSVSGGPAPSTGAALKQSDSNLSFLGRFGNMGINCSSSTTAPNQNSPAAAPEPQAIKKL
QTISERRKLFDDETPLRNGSSIVAKSHAKPEGDFITPLVRVRGSTQASKPRSAVSNEFRS
QKVLFQTPMTVGRGAPFPCDSFSLCDTISESPDIPPAKPEPQPKAEHINGKSKKSLDNAF
HEAENEMLPPKIEPVKPKEVVSVPIKKPEPLPPSISTKSSNNIIKIKDHEYAICQKLGCG
GSSSVYLARRPDSGGEFALKVVDLQADPTVVQGYLNETKLLEKLQGNVCVVALYDYQLLR
EESKLYVVMEKGDSDLNKILQSYTTNLPAYSLMSILYQMLQAVNYIHLHGVIHSDLKPAN
FLMVNGRLKLIDFGIASNISVDSTSIIKFSQAGTFNYISPEALTDISTGNSPMRGANQPK
IKISTKSDVWSLGCILYLLLYQKTPFGHIRNICAKMNAIANPGTNIEYPEIPFYYPAMLV
HMVKNCLQLNPKMRPSCAQLLQYPFHMVIPLQNLQIGSKGSTNQPTNK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgactactcctgtgccgcgccgcatcaaggacttgctagcgcttggtattgactcggac
acggacgatgactacaatacgcctctcaagccgcaccgatcaaatatcgcagccgcaaaa
aacccacggccagcggcggcggcatctgcattcggtcagagatcagtcatcggcttcaat
aatgctggcaataaggaaaacattccacttcacaatagggcagccggtgaagtgctgcca
cggcgcgtctctgaaatggccatgatggactcggacagcgatgaggaggatgataacaaa
aacgaccacaatctcaactgcgccattctcaatgattcctttgtgttgagtcccacgcac
gagttgtctgttagcggtggtccagctccctccacgggggccgcactcaagcaatctgat
tcgaatttgtcattcctgggacgcttcggcaatatgggcatcaactgcagcagcagcacc
actgcccccaatcagaactccccggcggctgcgccagaaccgcaggccatcaaaaagctc
caaacaatctcagagcgacgtaaactatttgatgacgagactcccctgcgcaatggatcc
tcgattgtggccaagtctcatgcgaagcccgaaggtgacttcataacgccactggtgcga
gtacgcggctctactcaggcatctaaaccccgcagtgcggtatccaatgagtttcgctcg
cagaaggttctcttccagacgcccatgaccgtgggccgtggcgctccctttccctgcgac
agcttctccctgtgcgacaccatcagtgagagtcccgacattcccccggcaaagccagag
ccgcagcccaaggcagagcacatcaatggaaagtcaaagaagtctttagacaatgctttc
catgaggcagaaaatgaaatgttgccgccaaaaattgagccagtgaaacccaaagaagtt
gtgtcggtgcccattaagaaaccagagccattgccgccctccatctccaccaaatcatcg
aacaacataataaagataaaggatcatgagtacgcgatatgccagaagctgggctgtggc
ggctccagttccgtttacctggcccgtcgtccggactctggtggggagtttgccttgaag
gtagtggatctgcaggccgatccgacggtggtgcaaggctatttgaatgaaaccaagctg
ctggagaagctgcagggcaacgtatgcgttgtggctttgtacgattatcaacttctgcgc
gaggagtccaagctgtatgtggtgatggagaagggtgactccgacttgaacaagatcctc
caaagctacaccacaaatctgcccgcctacagcctgatgagcattctgtaccagatgctg
caggctgtcaactatatccatttgcacggtgtcatacactcggacctgaagccggccaac
tttctgatggtcaatggccgtctgaagctgattgactttggaattgccagcaacatttcg
gtggactccaccagcatcataaagttctcccaggcgggcacctttaactacatcagtcct
gaggcgctcacggatatctcgacgggcaacagtcccatgcgcggtgctaatcagcccaag
ataaagatctccaccaagtcggatgtatggtccttgggctgcatactgtatctgctgctg
taccaaaagacgccctttggtcatatacgcaatatttgtgctaagatgaatgccattgcc
aatccggggacaaacattgagtatccagagatacctttctactatccagccatgctggtt
catatggtcaaaaattgccttcagctgaatcccaagatgcggccctcgtgcgcccaactg
ctacagtatcccttccacatggtcattcccctgcagaatctacagattggcagcaaaggc
agcaccaaccagccaacaaataagtag

DBGET integrated database retrieval system