KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20571Help
Entry
Dpse_GA20571      CDS       T01032                                 

Definition
GA20571 gene product from transcript GA20571-RA (EC:3.6.1.3)
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dpse_GA20571
  Replication and repair
   03420 Nucleotide excision repair
    Dpse_GA20571
Transcription machinery [BR:dpo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dpse_GA20571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 494 aa AA seqDB search
MADTKSGRYASAGSSNSVVPLVQGPANLECKDFQEYLRTRQTAETLEKLYNYPPICLAVF
RELPELARQFIIRILFVDQPVPQAVVTSWGAQRFAKEQTEATSCLSDLNVWRVTAIPGGL
SAWELSPTFKKSVRQVLLGGGKPWPMTNTLEKDSKPRDIAFLDSYAMSRWRCVLHYMVGT
GNRNGTDAEAISPDAVRILLHANLMKRDERDGITITRQGFQFLLLDTRAQVWHFMLQYLD
TCEERGVSLPECLSMLFQLSFSTLGRDYSSEGMNSQMLSFLQHLREFGLVFQRKRKEGRF
YPTRLALNVTSKEAATTMTVSDEEAMQDSGYIVVETNYRVYAYTDSPLQVAVLGLFTELL
YRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLQQYAHPNMKLVESAIQSKSCLPPTVVD
QIKLWEMERNRFTYTEGVVYNQFLSQNDFVTLRDYAQSIHVLVWQNERTRTMVVQKHGHD
DVKRYWKKYSKGGG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacaaaatctgggagatatgccagtgccggcagcagcaatagtgttgtgccc
cttgtgcaggggccggcgaatctggagtgcaaggatttccaggagtatcttcgcactcgc
cagactgccgagacgctggagaaactatacaattatccgccgatttgcctagccgtgttc
cgggagctgcccgaactagccagacagttcattatacgaattttattcgtggatcagccg
gtgccacaggctgtggttacctcctggggggcccagcgatttgccaaggagcaaaccgag
gccaccagctgcctctcggatctaaatgtttggcgtgtgacggccataccaggcggcctg
tctgcatgggagctgtcacccacattcaagaaaagcgttcgccaggttcttttgggcggc
ggcaagccgtggccgatgaccaatacactggagaaagactcgaagccacgtgacatagcc
ttcctggactcctatgccatgtcccgctggcgctgtgtgcttcattacatggtgggaacg
ggaaaccgtaatggcaccgatgcagaagcgatcagtccggatgctgtgaggattctactc
catgcaaatctcatgaagcgcgacgagcgagacggaattacaatcacccgccaagggttt
cagttcctgctgctggacacacgtgcacaggtctggcatttcatgctccagtatttggat
acatgcgaagagcggggagtatctcttccggagtgtctttccatgctgttccagctcagt
ttctccaccctcggtcgagactacagctcagagggcatgaacagccagatgttgtccttc
ctgcagcatttgcgcgagtttggtttggttttccagcggaaacgcaaggagggccggttt
tatcccactcgtcttgccctaaacgtgaccagcaaggaagcggctaccacaatgacagtg
tcagacgaggaggccatgcaggacagtggctacattgtggtagagacaaactatcgcgtc
tatgcctacacggattcccctcttcaagtggcggtcctgggcctgtttaccgagttgctc
tatcgctttcccaacttggtcgtgggcgtgctcacccgcgactctgtgcgtcaggcatta
cgcggcggcatcactgcagaacagattgtctcctatctgcagcagtacgcccaccccaac
atgaaactagtggagtcggccatccagtcaaagtcctgcctgccgcccaccgttgtggat
caaatcaagctctgggagatggagcgcaaccggttcacatacacggagggagtggtatac
aatcagtttctctcccagaacgatttcgtcactctgcgcgactatgcgcagtcgatccat
gtcttggtttggcagaatgagcgcactcgcaccatggtggtgcagaagcatggtcacgac
gatgtcaagcgctattggaagaagtattcgaagggtggcggttag

DBGET integrated database retrieval system