KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20589Help
Entry
Dpse_GA20589      CDS       T01032                                 

Definition
GA20589 gene product from transcript GA20589-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dpse_GA20589
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dpse_GA20589
Transfer RNA biogenesis [BR:dpo03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dpse_GA20589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 305 aa AA seqDB search
MASTAPVIMRIMASSIQTAKRAGGIIRDVLKQGDLGIVDKGKNDPQTEADRSAQRCIIAS
LTKKFPGVKIIGEEGGSDLNVCDDWLVEDLEEEFLQKSCPAEWRDAKPEDFVIWVDPLDG
TAEYTQGYVEHVTVLIGIAVKDAAVGGIIHQPFYQQPDGELGRTIWGLKGLGTGGFTHSL
APPGEFIITTTRSHSNALHQQALNAFPATKILKVGGAGFKVLQLLEGKAHAYVFATPGCK
KWDTCAPEAVLEAQGGFLTDINGKNYSYNADVEHVNRQGVLASVGENHSELVYKIPRKVR
EAVGV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgactgctccggttatcatgagaattatggcgtcttccatacagacagccaaa
cgagctggtggcatcatacgcgacgtcctaaaacaaggcgacctaggcatcgtggacaag
ggaaaaaatgatccccaaacggaggctgatcgttctgcccagcggtgcattattgcctcg
ctgacgaagaagtttcccggcgtaaagatcattggcgaggaaggcggctccgacttaaac
gtgtgcgatgattggctggtcgaagatttggaggaagagtttcttcagaaaagctgcccg
gccgaatggcgtgatgcaaaacctgaggattttgtgatctgggtagatccactggacgga
acagctgaatatacacagggttacgtggaacatgtcaccgtactcataggcatagccgtc
aaggatgctgcggtgggcggaatcattcatcagccgttttaccagcagcccgatggtgag
ctgggtcgcaccatttgggggctcaagggtctgggcacgggcggtttcacacattcgctg
gctccacccggagagttcatcataacgaccacacgatcgcactcgaatgccctgcaccag
caggcactcaatgcatttcctgccaccaaaatcctgaaagtgggcggcgctggattcaag
gtgttgcagctgctagagggcaaggcacacgcatatgtgtttgccacaccaggatgcaag
aaatgggatacttgcgcccccgaggccgtgctggaggcacagggcggctttctcacagac
atcaatggcaagaattattcctacaatgctgatgtggagcacgtgaatcggcagggagtg
ctggccagtgtgggcgagaatcactcggagctggtgtacaaaattccccgtaaggtgcgg
gaggctgtaggagtatga

DBGET integrated database retrieval system