KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20595Help
Entry
Dpse_GA20595      CDS       T01032                                 

Definition
GA20595 gene product from transcript GA20595-RA (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dpse_GA20595
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA20595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 151 aa AA seqDB search
MKVLWLLGLLVSWLSSLASARQVGRCSLARQLYRYGVPYGELPDWLCLVEGESSFNSKAI
NPSNVDGSVDWGLFQINDRYWCKPADGRPSTDLCRLPCRLLLSDDIRYSIACAKYIRRQQ
GFSAWVAWNTRCQGIKPNVNHCFRRRYRNSG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgctgtggctgctggggctattggtttcgtggctatcttccttggccagcgcc
cgccaggtgggaaggtgcagcctggcccgccagctctatcggtatggtgtgccttacggc
gagctgcccgactggctctgcctcgtggagggcgagagctctttcaacagcaaagccatc
aatccctccaatgtggatggctctgtggactggggtctcttccagatcaacgatagatac
tggtgcaagccagcggacggtcgtccctccacggatctctgtcgtctgccctgccgtttg
ctgctcagcgacgacatcaggtactccattgcctgcgccaagtacatcagacgccagcag
ggcttttccgcatgggtggcatggaatacccgctgccagggaatcaagccgaacgtgaac
cactgcttcagaagaagatacaggaactcgggatga

DBGET integrated database retrieval system