KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20611Help
Entry
Dpse_GA20611      CDS       T01032                                 

Definition
GA20611 gene product from transcript GA20611-RA (EC:2.7.11.-)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 771 aa AA seqDB search
MYRLEDTNSGGVMDKNKQKLSAYGSSAGTVAVDASQGGGNGGGGGGRQRHAPLYGRFVVE
EDLPATHRDVMHHHPSPSSSSEVRAMQARIPAHFRDPASGPLRKLSVDLIKTYKHINEVY
YAKKKRRAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSF
GQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMW
RNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKP
ENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCI
LVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVTDGSYVLKKNQ
NGRKYKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTP
YYALQHNFFKRTADESTNTSGAGATANAGAGGSGGGGCSGGGGGPGASTSSSSAVSASSA
PAAAAAAAASSSSTTSSTNTTGGGGGGNGSGGSTGSGLAVSASQQPMSLPLPLAGPGGVS
SSTSVVDAHSHGLHALMHSNAAASAMNNFSALSLQPAAHPSALAAHNSHHSSNSSSIHSN
SNSNNSSHSNSNSSHSNSLNSLNHINSNSNSGGGNSRRHMYGSNNSYSHPMDCDPPHGQV
MPPPPPNGRMRVPALLPMPNNYAPTSLPYYGNMSGGPRPQLLLLLPRPPLT
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattagaggatacgaatagcggcggcgttatggataagaataaacagaaatta
tctgcttatgggtccagtgcgggcaccgttgccgtggacgcatcgcagggtggtggtaac
ggtggtggcggcggcggcagacagcgtcatgcaccgctctatggacgctttgtggtcgaa
gaagatctgcctgccacgcatcgtgatgtgatgcatcatcaccctagtccttcgtcttcg
tcggaggtgcgtgccatgcaggcccgcattcccgcacactttcgcgatcccgcttcagga
ccattacgaaagctgagcgtcgatctgataaagacctataagcacatcaacgaggtatac
tatgcgaaaaagaagcgacgagcccaacaaacacagggcgacgatgattcgtccaacaaa
aaggagcgcaaattatataacgatggctatgacgatgataatcatgattatataatcaag
aatggtgaaaagttcttggatcgctatgagattgattcgctgatcggcaagggcagtttc
ggtcaagtggtgaaggcctacgatcacgaggagcaatgtcatgtggcgatcaaaataatt
aagaataagaaaccgttcctaaatcaggcacaaatcgaggtcaagctgctcgagatgatg
aatcgtgcggatgctgaaaataaatattatatcgtcaagctcaagcgtcactttatgtgg
cgcaaccatctgtgcctggtcttcgagctgctctcatacaacctgtacgatctgcttagg
aacacaaatttccgcggcgtctcgctgaacctcacgcgtaaatttgcgcagcaactgtgc
acggcgctgctgttccttagcacgcccgaactgaacataatacactgtgatttgaagccc
gagaatatcttgctatgcaacccgaagcgctcggccataaagattgttgactttggcagc
tcctgccagttgggacagcgcatctatcactacatccagtcgcgtttctaccgatcgcca
gaggtgctactgggcatacagtacgatctggccatcgatatgtggtcgctgggctgcatt
ttggttgagatgcacacgggcgagccgctcttctctggctgcaatgaggtcgatcagatg
aacaagattgtcgaggttctgggcatgccgcccaagtatctgctcgatcaggcgcacaag
acgcgcaagttctttgacaagatcgtcaccgatggctcctatgttctaaagaagaaccag
aatggacgcaaatacaagcccccgggatcgcgaaagctccatgacatactcggcgtggag
acgggcgggcccggtggtaggcgattggatgagcccgggcattcggtgtcggattatctc
aagttcaaggatctgatattgcgcatgctggactttgacccaaagacgcgcgtcacaccg
tactatgccttgcaacacaacttcttcaagcgcaccgccgacgagtcgaccaacacaagt
ggcgccggtgccacagcgaatgccggggccggtggcagcggcggcggtggctgcagtggt
ggtggcggcggaccgggtgcgagcaccagcagcagcagtgccgtctctgccagttcagcg
cccgcagcggcagctgcggcagcggccagttcatcctccaccacctcctcaacgaacaca
accggcggtggcggtggtggcaacggcagcggcggcagcactggctctggattggcggtg
tcggcgtcgcagcagccgatgtccctgccactgccactggcgggtccgggcggtgtatcg
tcgtcaacgtctgtggtggatgcccatagccatggtctgcatgcactaatgcactcaaat
gccgcggccagcgccatgaacaacttctctgccctcagtctgcagcccgccgcccatccg
tctgcgctggctgcccacaacagccaccacagcagcaacagcagcagcattcacagtaac
agtaacagcaacaacagcagtcacagtaacagcaacagcagccacagtaacagtctgaat
agcctaaaccacattaacagcaacagtaacagtggcggaggtaacagtcgccgccacatg
tacggcagcaacaacagctattcgcatccgatggactgcgatccgccgcacggccaggtg
atgccgcccccaccgcccaacggacgcatgcgtgtgccggccctgctcccgatgccgaac
aactatgcgccaacatccttgccctactacgggaacatgtcaggcgggccgcggccgcag
ctgctgctgctgctgccgcggccgcctctcacctga

DBGET integrated database retrieval system