KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20623Help
Entry
Dpse_GA20623      CDS       T01032                                 

Definition
GA20623 gene product from transcript GA20623-RA (EC:1.3.-.-)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Dpse_GA20623
    1.3.1.94  polyprenol reductase
     Dpse_GA20623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 323 aa AA seqDB search
MVLAIITSLEELIDQYNVNLTQLVFCIFITTIVFFGSLMTLVESHLPNSIRQSFRYGKHR
HKGEADALVSYLEVPKGWFKHFYIFAFGWSLLALYLIVSSIASQSAAPEYALRFLDLVCG
GATNRKVQVDSTTALLGTVLLTLQCIRRFYETNFVQIFSKHSKMNLSHYAVGYVHYFGAI
VSLLSNTAGFVRGSQPTEFTPKNLSQIQIIYFLVFMFAWHQQYSSNMILVNLRKDAKTGA
VKTEQHLLPKGGWFNLLSSPHMFFEVVMYFCLADLFTPVRTWKLVFLWVASNQTINALLT
HQWYKETFKDYPKRRRAILPYLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcgccataatcacctccctcgaggagctcatcgatcagtacaacgtaaacctc
acacaactggtattctgcatcttcatcacaaccatcgtgttctttgggagtttgatgacc
cttgtggagtcacatttgccgaatagtatacgccagtcgtttcgttatggcaagcacagg
cacaagggtgaagccgatgcgctggtcagttatttggaggttcccaaaggctggttcaag
catttctacatctttgcctttggttggtccctgctggcgctgtatttgatagtcagctcc
attgccagccaatctgcggctccggaatatgctctccgctttctggacctggtgtgcggc
ggtgccaccaatcggaaggtacaagtggactctacgacggctctactgggtacagttctg
ctcacattgcagtgcattcgccgcttctacgagacgaattttgtgcaaatcttctcgaag
cacagcaaaatgaacctgtcgcactatgccgttggctatgtacactactttggggccatt
gtctcgctgctgtccaacacggccggttttgtgcgcggatcgcagcccacggagtttacg
cccaagaacttgtcccaaatacaaatcatctactttttggtgtttatgttcgcctggcat
cagcagtactcgagtaatatgatattggtaaacctacggaaagatgccaaaacgggtgcc
gtgaagacagaacagcatttgctgcccaagggcgggtggttcaatctgttatcctcccca
cacatgttctttgaggtggtcatgtacttctgtctggcggatctgttcacgccagtgcgc
acctggaagctggtgttcctttgggtggccagcaatcaaacgatcaacgctctgctcacc
catcaatggtacaaggagacttttaaggattatcccaagcggcggcgtgccattcttccc
tatctgctgtga

DBGET integrated database retrieval system