KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20741Help
Entry
Dpse_GA20741      CDS       T01032                                 

Definition
GA20741 gene product from transcript GA20741-RA (EC:3.2.1.-)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dpse_GA20741
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dpse_GA20741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 706 aa AA seqDB search
MHSNLWIFIWRRKLSFLLVVSGLVLLGLWTWAILIDTTTTPPLPVPSANAEARERQQQQQ
NPGYQQVHIIQKLIAQANRVLRADRLKDNAAGEKAPTVQRLGNVRFLRPTQAKKAPLPLS
ESYLFEQERLKILEQQQRQRNAGMEELNANAEDERMLSSAERQTQYEHDLQRMGVPVVAG
IGPDGPRSPNERLVHLDLKGAPPKLSFLKQLLPMLRALGATGLLIEYEDMFPFTGALQPL
AAHNAYKEDELRDFLECAALHGLSVMPLLQTFGHLEYVLKLEGFEQLRELPESPQSICPS
QPQSMALLEQMLTQVIELHLQCIGKATPSAPTLPIKFTHIHIGCDEVQRMGECQACRQRL
RSELFLSHVISLSHFVRRHWPQLGVVIWDDQLRSMSLSELQHSQIGSYVEPMVWVYASDI
YRFIQPQLWDTYAKVFPSAWVASAYKGAFGESLLVPPLQHHLENNIRWLAVIAKEGGRFA
KGLRGVALTGWQRYDHFAVLCELLPVGMPSLMVSLSTVSKGYFSTNPRDNDLLRVLQCVF
QPDSRRSGRPWLELHPNAHHSQLFAVCNYPGHMVFKYALRLYDKLAEVGAYLQQTREQSA
WLSDYNVRHNFSSPLRVHELIARTPILMEELRAMAREAQQLLWEAYDEYTVAEFVEQHIY
PTIEALQRQLASGATLLQRRTWPQRPLPLTLRIQEDMGLVTDRQPH
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgcactcgaatctgtggatatttatttggcgccgcaaactctccttcctgctagtagtg
tctggcctcgtgctgctgggtctctggacatgggccatactcatcgatacgaccaccacg
ccaccactgccggttccctcagcgaatgctgaggcaagagagcgccaacagcagcagcag
aacccgggataccagcaggtccatattatccagaagctaattgcccaggccaaccgtgtg
ctccgcgccgatcgactcaaggacaacgccgccggagagaaggcgccaactgtccagcgt
ctgggcaacgtgcgattcctgcgtcccacccaggccaagaaggccccactgccgctgtcc
gagagctatctgttcgagcaggagcgcctgaagatactcgaacagcagcagcgtcagcgc
aacgccggaatggaggagctgaatgccaatgccgaggatgagcgtatgctcagctctgcc
gagcgccagacccagtacgagcacgatctccagcggatgggcgttcccgtggtggctggt
atcggaccagacgggccacgttcccctaacgagcgtctcgtccacttggatctgaagggg
gccccgcccaagctgagtttcctcaagcaactgctgccgatgctcagggctctgggtgcc
acggggctactgatcgaatacgaggatatgtttccctttactggagccctccagccgctg
gccgcccacaatgcctacaaagaagatgaattgagggactttctggagtgcgccgccttg
catggtttgagtgtgatgcctctgcttcagaccttcgggcatttggagtatgtcctgaaa
ctggagggattcgagcagctgcgagagctgcccgaaagtccccaatccatctgccccagt
cagccgcagagcatggccctgctggagcagatgctcacccaggtgatcgagctgcattta
cagtgcatcggcaaggccaccccctcagccccgacactgcccatcaagttcacgcacatc
cacatcggatgcgatgaggtgcagcgcatgggggagtgccaggcctgccgccagagactc
cggagcgagctgttcctgtcgcacgtgatcagtctctcgcactttgtgcgtcgccactgg
ccccaactgggcgtggtcatctgggatgatcagctgcgatcgatgtcactcagcgagctg
caacactcgcagatcggcagctatgtggagcccatggtgtgggtgtatgccagcgatatc
tatcggttcatccagccgcagctgtgggacacctatgccaaggtctttcccagtgcttgg
gtggcctcggcctacaagggagccttcggcgagagcctgctggtgccgccgctgcagcat
catctggaaaataacatacgctggctggcggtcatcgccaaggagggcggacgctttgcc
aaaggactgcgcggtgtggctctaaccggctggcagcgatacgatcactttgccgtcctg
tgcgaactgctgccagtgggaatgcccagcctgatggtgtcgctgtcgactgtttccaag
ggttatttcagcactaatccaagggacaacgatctgctgcgcgtgctgcagtgcgtcttt
cagccggacagccggcgctcgggtcgcccctggctggagcttcatccgaatgcccatcat
agccaactgtttgctgtctgcaactatcccggccacatggtcttcaagtatgcccttcgc
ctgtacgacaaactggccgaagtgggagcctatctacagcagacgcgcgagcagagcgcc
tggctctccgactacaatgtgaggcacaacttcagctccccgttgagagttcacgagctg
attgcccgaacgccaatactaatggaggagctgcgcgcaatggctcgcgaggcacagcag
ctgctgtgggaggcgtacgatgagtacacggtggctgaatttgtagagcagcacatctat
cctaccatcgaggcgctgcagcgccaattggccagcggagcgacgctgctccaacgccgc
acctggccacaacggccgctgccattgaccctgaggatacaggaggatatgggcttggtc
acagatcgccagccgcactga

DBGET integrated database retrieval system