KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20741Help
Entry
Dpse_GA20741      CDS       T01032                                 

Definition
GA20741 gene product from transcript GA20741-RA (EC:3.2.1.-)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dpo00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 706 aa AA seqDB search
MHSNLWIFIWRRKLSFLLVVSGLVLLGLWTWAILIDTTTTPPLPVPSANAEARERQQQQQ
NPGYQQVHIIQKLIAQANRVLRADRLKDNAAGEKAPTVQRLGNVRFLRPTQAKKAPLPLS
ESYLFEQERLKILEQQQRQRNAGMEELNANAEDERMLSSAERQTQYEHDLQRMGVPVVAG
IGPDGPRSPNERLVHLDLKGAPPKLSFLKQLLPMLRALGATGLLIEYEDMFPFTGALQPL
AAHNAYKEDELRDFLECAALHGLSVMPLLQTFGHLEYVLKLEGFEQLRELPESPQSICPS
QPQSMALLEQMLTQVIELHLQCIGKATPSAPTLPIKFTHIHIGCDEVQRMGECQACRQRL
RSELFLSHVISLSHFVRRHWPQLGVVIWDDQLRSMSLSELQHSQIGSYVEPMVWVYASDI
YRFIQPQLWDTYAKVFPSAWVASAYKGAFGESLLVPPLQHHLENNIRWLAVIAKEGGRFA
KGLRGVALTGWQRYDHFAVLCELLPVGMPSLMVSLSTVSKGYFSTNPRDNDLLRVLQCVF
QPDSRRSGRPWLELHPNAHHSQLFAVCNYPGHMVFKYALRLYDKLAEVGAYLQQTREQSA
WLSDYNVRHNFSSPLRVHELIARTPILMEELRAMAREAQQLLWEAYDEYTVAEFVEQHIY
PTIEALQRQLASGATLLQRRTWPQRPLPLTLRIQEDMGLVTDRQPH
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgcactcgaatctgtggatatttatttggcgccgcaaactctccttcctgctagtagtg
tctggcctcgtgctgctgggtctctggacatgggccatactcatcgatacgaccaccacg
ccaccactgccggttccctcagcgaatgctgaggcaagagagcgccaacagcagcagcag
aacccgggataccagcaggtccatattatccagaagctaattgcccaggccaaccgtgtg
ctccgcgccgatcgactcaaggacaacgccgccggagagaaggcgccaactgtccagcgt
ctgggcaacgtgcgattcctgcgtcccacccaggccaagaaggccccactgccgctgtcc
gagagctatctgttcgagcaggagcgcctgaagatactcgaacagcagcagcgtcagcgc
aacgccggaatggaggagctgaatgccaatgccgaggatgagcgtatgctcagctctgcc
gagcgccagacccagtacgagcacgatctccagcggatgggcgttcccgtggtggctggt
atcggaccagacgggccacgttcccctaacgagcgtctcgtccacttggatctgaagggg
gccccgcccaagctgagtttcctcaagcaactgctgccgatgctcagggctctgggtgcc
acggggctactgatcgaatacgaggatatgtttccctttactggagccctccagccgctg
gccgcccacaatgcctacaaagaagatgaattgagggactttctggagtgcgccgccttg
catggtttgagtgtgatgcctctgcttcagaccttcgggcatttggagtatgtcctgaaa
ctggagggattcgagcagctgcgagagctgcccgaaagtccccaatccatctgccccagt
cagccgcagagcatggccctgctggagcagatgctcacccaggtgatcgagctgcattta
cagtgcatcggcaaggccaccccctcagccccgacactgcccatcaagttcacgcacatc
cacatcggatgcgatgaggtgcagcgcatgggggagtgccaggcctgccgccagagactc
cggagcgagctgttcctgtcgcacgtgatcagtctctcgcactttgtgcgtcgccactgg
ccccaactgggcgtggtcatctgggatgatcagctgcgatcgatgtcactcagcgagctg
caacactcgcagatcggcagctatgtggagcccatggtgtgggtgtatgccagcgatatc
tatcggttcatccagccgcagctgtgggacacctatgccaaggtctttcccagtgcttgg
gtggcctcggcctacaagggagccttcggcgagagcctgctggtgccgccgctgcagcat
catctggaaaataacatacgctggctggcggtcatcgccaaggagggcggacgctttgcc
aaaggactgcgcggtgtggctctaaccggctggcagcgatacgatcactttgccgtcctg
tgcgaactgctgccagtgggaatgcccagcctgatggtgtcgctgtcgactgtttccaag
ggttatttcagcactaatccaagggacaacgatctgctgcgcgtgctgcagtgcgtcttt
cagccggacagccggcgctcgggtcgcccctggctggagcttcatccgaatgcccatcat
agccaactgtttgctgtctgcaactatcccggccacatggtcttcaagtatgcccttcgc
ctgtacgacaaactggccgaagtgggagcctatctacagcagacgcgcgagcagagcgcc
tggctctccgactacaatgtgaggcacaacttcagctccccgttgagagttcacgagctg
attgcccgaacgccaatactaatggaggagctgcgcgcaatggctcgcgaggcacagcag
ctgctgtgggaggcgtacgatgagtacacggtggctgaatttgtagagcagcacatctat
cctaccatcgaggcgctgcagcgccaattggccagcggagcgacgctgctccaacgccgc
acctggccacaacggccgctgccattgaccctgaggatacaggaggatatgggcttggtc
acagatcgccagccgcactga

DBGET integrated database retrieval system