KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20751Help
Entry
Dpse_GA20751      CDS       T01032                                 

Definition
GA20751 gene product from transcript GA20751-RA (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dpse_GA20751
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dpse_GA20751
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA20751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 576 aa AA seqDB search
MTEGKNIPNSSADVPFRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTTPDFKEIAAHR
VELSVITPQDGWYEQDPLEIMASINKCAEEAIKQLPEQGFSASDIASVGITNQRETTIVW
DAVTGKPLYNAIVWKDIRTSSTVDQIVAKVQDPNHFRNITGLPISTYFSALKIRWLKDNV
PEVRQAIRGKRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMNLETQNWDPVLLKTFA
IKEDMLPTIRSCSEIFGKITSERSPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSG
CFLLCNTGDKPVFSRHGLLTTVAYKLGPQSPTIYAIEGAVSVAGHALSWLQSKVRILPDS
RDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQNARGIIIGLTQFTRKNHIVRAALESICF
QTRDILECMHQECGYEINKLHADGKLTTNNLLMQLQADTIGMPVFRSQLMDSTAFGAAMC
AAQAEGIDLCKFEPEKRYYENVHYDTFLATTTDVERKERYGKWKRAVERSLGWVIKQKKT
REHTEENYRMLSSLPASIFLISSFAMLVHSFAATSQ
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgacggagggcaagaacatacccaactccagcgcggatgtgccgttccgtagcaaggag
ctgcgcaagcagtcgctgatccaacacacgggcctggtgggcgtcatcgacgagggcacc
aagaccatcggcttctccatttacacgacgcccgacttcaaggagatcgccgcccatcga
gtggagctgagcgtgataacgccccaggatggctggtacgagcaggatccgctggagatc
atggcatcgatcaacaagtgtgccgaggaggccatcaagcagctgccagagcagggcttc
agcgccagcgacattgcctccgtggggatcactaaccagcgcgagacgactatcgtctgg
gacgccgtcacaggcaagccgttgtacaatgcgatcgtgtggaaggatatacgcaccagc
agcaccgtggatcagatcgtggctaaggtgcaggacccgaatcatttccgcaacatcact
ggcttgccgatctccacgtacttctcggccctgaagatccgctggctgaaggacaacgtg
cccgaggtgcggcaggccatccgcggaaagcgctgcaaggcgggcaccgtcgacagttgg
attgtgtggaatctgacgaacggtgcccttcacatcacggacgtgacgaatgcctcgcgc
acgctgctcatgaacctcgaaacccagaactgggaccccgtgctgctgaagacgttcgct
atcaaggaggatatgctgcccaccatccgcagctgctcggagatctttggtaagatcacc
tcggagcggagtcccctgcgcggcatgacgctcagcgggatcatggggaaccagcaggcc
tcgctgcttggccagatgtgcgtcaagccgggccagaccaagaacacgtatcgctctggc
tgcttcttgctttgcaacacgggcgacaagcccgtcttttcgcgccacggactgctgacc
accgtagcttataagctgggaccgcagtcgcccacgatctacgccatcgaaggagccgta
tccgtggccggacatgccctgtcctggttgcagagcaaagtgcgcattctgcccgactcc
cgggacgccgagaagtacgccgagatggtacccacgtcaggggatgtctactttgtgccc
gccttcaccgggctgtacgctccctactggcgccagaatgcgcgtggcataatcatcggt
ctgacgcagttcacgcgaaagaaccacattgtgagagcggcacttgagagcatctgcttc
cagacacgcgacatcctcgagtgcatgcatcaggagtgcggctacgagatcaacaagctg
catgccgatggcaagctcacgacgaacaacctgctgatgcagctccaggcagacaccatc
ggcatgcccgtgttccgctcccagctgatggactcgacggccttcggggcggccatgtgc
gccgcccaggcggagggcattgatctgtgcaagtttgagccggagaagcgctactacgag
aacgtgcactacgacacgttcctggccaccaccacggatgtggagcgaaaggagcgctac
ggcaagtggaagcgggccgtcgaacgtagtcttggctgggtcatcaagcagaagaagacg
cgcgagcacaccgaggagaactaccgcatgctgtcgtcgctcccagcgagtatattcctc
atcagcagctttgcgatgctggtgcactcctttgcagcgacctcccagtag

DBGET integrated database retrieval system