KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA20997Help
Entry
Dpse_GA20997      CDS       T01032                                 

Definition
GA20997 gene product from transcript GA20997-RA (EC:3.1.2.15)
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dpse_GA20997
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dpse_GA20997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 1775 aa AA seqDB search
MGTKESKHACISYEDAVKRMSDTELRRLKDAFKKSAGVGRLYLSRNAFQQDVLCEGVPPK
ITDMLYAACGGTQRGISFKDLLCGLVLITRGSQEEKTKFLWNLYCNDSGTYIVKSDYVRN
VNLAPFESVSLFAQSERVNFEQFQDWIVKHRNATVLSKWLLADNCVSLTSELETPTFYQS
LAGVTHLEEKDIGDLEKEFWRLKNTSQNGQIDLQFLGPLISPPIPKNALAGLFNAFDENR
DGHIDFKELCCGVSAACRGPGVERTRFCFKIFDVDRDGVLSHEETMQMINVLLFVAKENR
DSQQYKELTKQLVISDLLEFGQRKSPDGAPSNVTRDNVSLTAEDFMLWNVECNLRLMQPL
LDLIFELCHIVFGLWPQCKHMENDIVRGWLRREERRPYRVGQFWYLISRDWWLNWMSYTQ
HTAHTCDYCKRTASQRSAVDEALVCDESFNTHSLEQHDSYSLGSGSGSGSASSGISAGRH
CGPVRPGAIDNSNLITANPYRNVRTLTGEGGHLKRDTPIVQSHDFELVPKSLWKALNRWY
GDNLPLPRQVIQPPNTDVELELYPLNLRILLHQAQPSQTSLAAGAGAQLGSWGSTVSGGY
GVLASGGGYAAIAASSVLQPPKRYLAYTAAFSRLATVRQVGEFLCEQLRLKAEDIRLWHV
PQLDNGAILLEEDAMCLKELFIRDNDQLLLEIRNKDLTWPEELGSLASAQSGQGTGGAPG
DRRRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFELNAAN
KLGTRGQLAMRYAELLKEVWTATTRSVAPLKLRFCVNKHAPQFAGGGQHDTQELLEWLLD
ALHEDLNRVMEKPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLG
CGHESVRFDPFSLLSLPLPVENYVYLEVLVILLDGSVPIKYGLRLNSECKYGDLKHKLAT
LCPLQPSLMLVCELWNSQIRQLVGDEDKLRTQTAKELYVYQLPEQSSVRTRSNSVLSTHI
EQGLKDIQRTSASALATTQQDSLSSLSTLQTSSKALCNGYGSEADQMPEVARYISINSNG
SGNGNGSSGQVHELLPDDAGKESLILSCSPENTFMHGTAATQQKRVSSAKLLHTESNTSS
MSYTNQSGENSMESSLTDPMPIVELAMVAGSSRHGSGSGDDNSYRTTPNDSSGLSTGHTL
GAASSLEEGHDVDDVGEHADAEEGEDLDMDLHITTSQPETSSGVYSRRSSQPHRAGKYLV
AVHRKITRHDSYFLSYHKTRPSLFGVPLLIPNCDGGTHKDLYCAVWLQVSRLLSPLPATT
EQANHAADCDDSLGYDFPFTLRAVKADGLTCAICPWSSFCRGCEIRCNNEYVLQGALPPI
SAVAASNTPTPKMNAKFPSLPNLEVKRTPEYTASLSYTPTTKYFEDFTIAIDWDPTALHL
RYQSTLERLWVDHETIAICRREQVEPVDLNHCLRAFTSEEKLEQWYYCSHCKGKKPATKK
LQIWKLPPILIVHLKRFNCVNGKWVKSQKVVHFPFDEFDPTPYLASVPQETILRHKELLE
LKADSDSMTKAMPRNQIVNELDEIQDQAKEDQTTDSASTSTTTTTSTSASTSTSKVATGA
TGNTGNVLRQSKTNNAARRQRLISTSLTKTPIVDGEFEDYHQHRLKPDVDEFDPKYKLYA
VVSHSGMLNGGHYISYASNSSGSWYCYNDSSCREISQKPVIDPSAAYLLFYERKGLNYEP
YLPNIEGRALPHNASGLQLDVDETEGELKKLCAIS
NT seq 5328 nt NT seq  +upstreamnt  +downstreamnt
atgggcacaaaggagtcgaaacatgcctgcatcagctacgaggatgcagtcaaacgtatg
agcgacacggagctgcgacgcctgaaggatgcctttaagaagtcggcgggcgtgggacga
ctctacctcagccgcaatgccttccagcaggacgttctgtgcgagggcgtgccgccgaag
atcactgacatgctctatgccgcctgcggtggcacccaacgcggcatctccttcaaggac
ctgctctgcggactggtgctgatcactcgcggctcccaggaggagaaaaccaaattcctg
tggaacctctactgcaacgactctggcacctacatcgtcaagtcggactatgtgcgcaac
gtgaatttggctccgttcgagagtgtctccttgtttgcgcaaagcgaacgtgtcaatttc
gagcagtttcaggactggattgtgaagcatcgcaacgccaccgttctttccaaatggctc
ctcgccgataattgcgttagcctcacctcagagctagagacgcccacattctatcagagc
ctggctggagtcacacatttggaggaaaaggacattggagatctggagaaagagttctgg
cgtttgaagaatacttcccagaatggccaaatcgatttgcagttccttggccccctgatc
agcccccccataccaaagaatgcactggccggactcttcaatgccttcgatgagaatcgc
gatggccacatcgacttcaaggagctgtgctgtggtgtaagtgcagcctgtcgtggacca
ggtgtggaaaggacgcgcttctgctttaagatattcgatgtggatcgggatggagtgctg
agccatgaggagaccatgcaaatgatcaatgttctgctgtttgtggccaaggagaaccgg
gactctcagcagtacaaggagctcactaaacagcttgtcatcagcgatctcctcgagttt
gggcagcgcaaaagtccggacggggcacccagcaacgtcacgcgcgacaatgtctccctg
acggccgaggactttatgctatggaacgtggagtgcaatcttcggctgatgcagcccctt
ctggacctcatcttcgagctttgccacatcgtcttcggcctctggccgcagtgcaagcac
atggagaacgacatcgtccgtggctggctgcgacgcgaggagcggcgtccgtatcgcgtt
ggccagttctggtatctcatatcgcgcgactggtggctcaactggatgtcgtacacccag
cacacggcccacacttgcgactactgcaagcgcaccgccagccagcgcagtgctgtggat
gaggcgcttgtatgcgacgagagcttcaacacccacagcctcgaacagcacgatagctac
tcgctgggctctggctctggatcaggctcggcaagcagcggcatttcggctggccgccac
tgcggtcccgtgcgtccgggggccattgacaacagcaatctaatcacggccaatccctac
cggaatgtgcgcaccctcaccggcgagggcggccacctgaagcgggacacgcccatcgtg
cagagccacgactttgagctggtgcccaaatctctgtggaaggctctgaatcggtggtac
ggcgacaatctgccattgccccgtcaggtcatacaaccgcccaacacagatgtggagctg
gagctttatcctttgaacctacgcatcctgctgcaccaggcgcagccatctcagacgagt
ctggccgcaggagcgggagcacagcttggaagctggggctccacagtaagcggcggctac
ggggtcctggcctcgggcggtggctatgcagccattgcggccagcagcgtgctgcagccc
ccgaagcgctacctggcctacacggcggccttcagtcgcttggccacagtgcgtcaggtg
ggggagttcctgtgcgagcagctgcgcctcaaggcggaggatatacggctgtggcacgtg
ccgcagctggacaacggtgccatactactggaggaagatgccatgtgcctgaaggagctc
ttcattcgcgacaacgaccagctgctgctggagatacgcaacaaggacctgacctggcca
gaggagcttggctcgctggccagtgcgcagagcggccagggcaccgggggggctcctggt
gaccgacgacgcctcacccgcagctccatcatgtctgtgcacgcaccgggcgccacgggg
ctgcacaatctaggcaacacctgcttcatgaacgccgccctgcaagtgctctttaacacc
cagcccctggcccagtacttccagcgtgagatgcaccgcttcgagctgaacgcggccaac
aagctgggcacccgcggacagctggccatgcgctacgcggagctgctcaaggaggtgtgg
acggcaacgacgcgctcagtggctccactgaagcttcgcttctgtgtaaacaagcatgcg
ccacagtttgccggtgggggccagcatgacacacaggagctgctcgagtggctgctggat
gccctgcacgaggacctcaaccgggtgatggagaaaccgtatagcgagctaaaggactcc
aatggacggcccgacaagatcgtggccgccgaagcctggtcgcagcaccatgcccgcaat
cagtcgatcatcattgaccttttctacggccagcttaagtccaaggtgagttgtctgggt
tgtggccacgaatcggtccgcttcgatccgttcagtctactcagtctgccgctacccgtt
gagaactatgtgtacttggaggtgttggttatcctgctcgatgggagcgttcccatcaag
tacggactgcgcctcaactcggagtgcaagtatggagatctgaagcacaagctggccacc
ctctgcccgctccagccgagcctgatgctggtgtgcgagctctggaactcgcagatacgc
cagctggttggggacgaggacaagctgcgcacgcagaccgccaaagaattgtatgtgtat
cagctgccagagcagagtagcgttcggacgcgatccaattcggtgctcagcacgcacatc
gagcagggtctgaaggatatacaacggacctcagcctctgctctcgccaccacccagcag
gactcgttgtcttcgttgagtactctgcaaacctccagcaaggctctgtgcaatggatat
ggctccgaggcggaccaaatgccggaggtggccagatacattagcatcaacagcaatggc
agcggaaacggaaacggaagcagtggccaggtgcacgaactgctgccagatgatgccgga
aaggagtcgctcatcctgagctgcagtccggagaacacttttatgcacggcacagccgcc
acacagcagaagcgcgtctcctccgccaagctgctgcacacggagagcaacaccagctcc
atgtcgtacacgaatcagtcgggcgagaactcgatggagagctccctgacggatcccatg
cccattgttgagctggccatggtcgcgggcagcagtcgccatggcagcggaagcggcgat
gacaactcgtatcggacgacacctaacgactccagtggcctgagcactggccacacgctg
ggggcagcctccagtctggaggagggtcacgatgtggatgatgtgggagagcatgccgat
gccgaggagggcgaggatctggatatggatctgcacataacaacctcacagccggagacc
agcagcggcgtctactcgcgtcgctcctcgcagccccacagggcgggcaagtatctagtg
gctgtccaccgcaagatcacgcgtcacgacagctacttcctctcgtaccacaagacgcgg
cccagcctcttcggggtgcctctgctcatacccaactgcgatggcggcacccacaaggat
ctgtactgcgctgtctggctgcaggtgagccgactgctcagtccattgcccgcgacaaca
gagcaggcgaatcatgccgccgattgtgacgacagtctgggctacgactttcccttcacg
ttgcgagccgtcaaagccgatggcctcacctgcgccatttgtccgtggtcgagcttctgt
cggggctgcgagatacgctgcaacaacgaatatgtgctccagggcgccctgccgcctatc
agtgctgtggctgccagtaatacgcccacaccgaaaatgaatgccaagttcccatcgcta
ccaaatctggaggtcaaacggacacccgagtacaccgcttcgttgtcgtataccccaaca
acaaaatactttgaagactttaccattgccatcgactgggatccgaccgccctgcattta
cgctaccaaagcaccttggagcgtctttgggtggaccacgagaccattgccatatgtcgg
cgggagcaagtggagcccgtggacctgaatcattgcttgcgcgccttcacctccgaggag
aagctggagcagtggtattactgcagtcactgcaagggcaagaagccagccaccaagaag
cttcagatttggaaacttccaccaatattaattgtgcacttgaagcgcttcaactgtgtc
aacggcaagtgggtcaaatcgcagaaagtggttcatttcccgtttgacgaattcgatccc
acgccgtatctggcatcagtgccgcaggagacgatattgcggcacaaagagttgctggaa
ctgaaagcagacagtgatagtatgacaaaggcaatgccacgcaatcaaattgtgaacgaa
ctggatgagatccaggaccaggcgaaggaggaccaaacaacagactctgcttcgacttcg
acgacgacgacgacgtccacgtcagcgtcaacgtcaacgtctaaagttgctacgggagct
actgggaatacgggaaatgttttacgccagagcaaaacgaataacgcggccaggcgacaa
cgcctcatctcaacgagtctcaccaagacgcccattgtggatggcgaattcgaggactat
catcagcaccgccttaagccagatgtggatgagttcgatcccaagtacaagctgtatgct
gttgtgtcccactctggtatgctgaatggcggccactacatttcttatgcatcgaattcg
tctggctcgtggtactgttacaacgacagctcctgccgcgagatatcccaaaagcccgtg
atcgatccaagtgccgcatatctattgttttacgagcgcaagggtctcaactatgagccg
tatctgcccaacattgagggtcgagcgctgccccataatgcctctggtctgcagctcgat
gtggacgagaccgaaggcgagctaaagaagctgtgtgcaatttcctaa

DBGET integrated database retrieval system