KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21205Help
Entry
Dpse_GA21205      CDS       T01032                                 

Definition
GA21205 gene product from transcript GA21205-RA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dpse_GA21205
Protein phosphatases and associated proteins [BR:dpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dpse_GA21205
Ubiquitin system [BR:dpo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Dpse_GA21205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 932 aa AA seqDB search
MMIQEPVQAAIWHCMNYYDHKDAVFLAERLCSEVECDETIFLLATSYFRSNLVHQAYWLL
KEKARRSAQCRFLQAKCAYELKKFAEAESALINTGFADAKNFDELQRDFGELACFAYQLI
AQICIKTERNKLAATALRRALKLNPFMWHAFADLCLLGQDMDTASIFQIQSTDVFNTCQG
SSANATSMVLFGNEQQQHQQQQVQQTALENVLTKISNISNYVWTTPVDHHQAQQQQQQNQ
NQHQLGINNNSSNLMTPINNNNINNNLNSSMSMLRGGGVAQNSSMLAMLEDTPMGCPQET
GQPQPQQQQSQLYDVSSVTPFRKQFKYLSTISPTTPSFGVWPLTSPCSGSDGSFVGGGSV
VSGNGTHTPVMNITYSPMTQMLVEVNQEPKMMGKKLKTHVGGLISRKDTSSNSNKPAVFT
QAGNITPRTPNNNVGNGNNLNVPPNPNAAVRRSSRLFSNSAYSVKENNKSPNIANNKFVQ
PRSPPRKTKSRMTKICLNNELIEEKTSHLSDKLSDKQARKEKVETITSAANNNNNRSAAE
EAKVLLNNNLNNAQTMAHQLLSLKKQSADGLMSLLRDLAEAYKLISMFQCKSAIKQLETT
IPKHHLNSSWVQSLIGLCRYEMRDYEAAVVLFEAIHKAEPCRLDYMEIYSTSLWHLQKEV
ELSSLAQDLISQNKSSPVTWCVSGNCFSLHKEHETAIKFFKRAVQVDPDFVYSYTLLGHE
LVLTEEFDKAMDYFRAAVVRDPRHYNAWFGIGTIYSKQEKYELAEIHYMKALKINPQNSV
ILVHIGTIQFYMKKKDLSLQTLNTAATLDPKNPLARFHRGSIYHSLGKYQEALRELEELK
EIVPKESVVFYLIGKIHKTLGNMDLALMHFSWATDLDPKGANNQIKDAFDSMAHPSCCTA
NTTALDVDLEPNSERSDDSTQAQQDVSYDSDY
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgatgattcaggagcctgttcaggcagccatatggcattgcatgaactactacgaccac
aaagatgctgtttttttggcggagcgcctgtgctctgaagtggaatgcgacgagacgata
tttctactggccaccagctactttcgctccaatctcgtgcaccaggcctattggctgctc
aaggagaaggcgcgccgctcggcccagtgccgcttcctacaggccaagtgcgcctacgag
ttgaagaagtttgccgaggccgagagcgcactgataaacactggatttgcggacgcgaaa
aacttcgacgagctgcagcgtgactttggagaattggcttgctttgcctaccagctgata
gcacaaatctgcataaagaccgagcgcaacaagctggccgcaactgctctgaggcgggct
ctgaagctgaaccccttcatgtggcatgccttcgcggatctgtgcctgctgggccaggac
atggacactgcgtcaatattccaaatccaaagcacggatgtgttcaacacctgccaaggc
agcagcgccaatgctacttccatggtgctattcggcaacgagcagcaacagcaccagcag
cagcaggtgcagcaaacggctcttgagaatgtactcacgaagataagcaatatctccaat
tacgtttggaccacaccggtggatcatcaccaggcacagcagcagcaacaacagaatcag
aaccagcatcagcttgggataaacaacaacagtagcaacctgatgacgcccatcaacaat
aacaacatcaacaacaatctcaacagctccatgagcatgcttcgaggcggaggagtcgcc
cagaactccagcatgctggcgatgctggaggatacgcccatgggctgtccccaagagacg
ggccagccgcagccgcagcagcagcaaagtcaattgtacgacgtcagcagtgtcactccg
ttccgtaaacaattcaaatacctatccaccatctcgcccaccactcccagcttcggggtt
tggcccttgactagtccctgttctgggagcgatggctcattcgtcggtggcggtagcgtt
gtcagcggcaacggaacccacactccagtcatgaatatcacgtactcccccatgacccaa
atgctcgtcgaggtcaaccaggagcccaagatgatgggcaaaaagctgaagacacatgtg
gggggactgataagccgcaaggacaccagcagcaacagcaacaagcccgccgttttcacc
caagccggcaatataacgccgcgaacacccaacaataatgtgggcaacggcaataatctt
aatgtgccgcccaatcccaacgccgctgtgcgccgcagctcgcgcctgtttagcaattcc
gcctactctgtaaaagagaacaacaagtcgcccaacatagccaacaataagtttgtgcag
ccacgctcgccgcccaggaagaccaagtcccgcatgacgaagatctgcctaaacaacgag
ctgattgaggagaagaccagccacttgtcggacaagctgagcgacaagcaggcgcgcaag
gagaaggtcgagacgattacgtcggcagccaacaacaacaataaccgcagtgccgccgaa
gaggccaaggtgctgctaaacaacaacctgaacaatgcccagaccatggcccatcagctg
ctaagtctaaagaagcagtcggccgacggtctcatgtcgctgctccgcgacttggccgag
gcctataagctgatctcgatgtttcagtgcaagtcggccatcaagcagctagagacaacg
ataccaaagcatcatttgaattccagttgggtgcagtccctgattggcctgtgcagatac
gagatgagggactacgaagcggcggtggtgctcttcgaggccatacacaaggcggagccg
tgtcgcttagactacatggagatatactcaacatccctatggcatttacaaaaggaagta
gagctgtcctcgctggcccaggacctcatcagtcagaacaagagcagtccagtgacctgg
tgtgtgtccggcaactgtttctccctgcataaggagcacgagacggccatcaaattcttc
aagcgagccgtccaggtggatcccgacttcgtctacagctacaccctgctgggccacgag
ctggtgctcaccgaggagtttgacaaggccatggactacttccgagcggccgtcgtgcgc
gatcccagacactacaatgcctggtttggtattggcaccatctactccaagcaggagaag
tacgaactggccgagatccactacatgaaggccttgaaaatcaatccgcagaactctgtg
atcctggtgcacatcgggacgattcagttctacatgaagaagaaggacctctcgctgcag
accctcaacacggctgccacactggatccaaagaatccgctggcgcgattccatcgaggc
tcgatataccactcgctgggaaagtaccaggaggccctgcgtgagctggaggagctcaag
gagattgtgccaaaggaatctgtggtcttctatctcattggcaaaatacacaagactctc
ggcaacatggatctggcactgatgcacttcagctgggccaccgatctcgatcccaagggg
gccaacaatcaaatcaaagatgccttcgactcaatggcccaccccagctgctgtacggcc
aacacgactgccctcgatgtcgatctcgagcccaattccgagcgatccgatgactcgacg
caggctcagcaggatgttagctacgacagtgactactaa

DBGET integrated database retrieval system