KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21245Help
Entry
Dpse_GA21245      CDS       T01032                                 

Definition
GA21245 gene product from transcript GA21245-RA (EC:1.2.1.- 1.5.1.6 2.1.1.- 2.1.2.-)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dpse_GA21245
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     Dpse_GA21245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 913 aa AA seqDB search
MALKLRIAIIGQSNFAADVLELLLERSNIQIVGVFTIPDKGSREDVLATTAAAHKIPVFK
FSSWRRKGVALPEVLAQYKSVGATLNVLPYCSQFIPMEVIDGASLGSICYHPSILPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLTRQTNLEPTDTLDSIYKRFLYPEGVKA
MGVAVDMVANGTAPKITQTEIGATYDPAMFKADNQLINLQQPAERIWNFVRGLDSVPGAI
ATVLLQDGTEEQIRLFGAHLYSAGPVSNGQPLRLKGLTKPAWIHTLGLLIEGTDGAFVNV
RRIKRGSKVINASEWFKQAEQQPITDFSEDELSKKGILSAIWQAILKEPIEDSTDFFAAG
AGSMDVVRLVEEVKEAFDVPLENDNVFMAPVFEEFFGQLVKILRQGSGGSGGQQLIYDGF
TLKANKREIQVPTQLFIDGEFVDAEGKRTLEIVNPTDEKVLCKVACASPKDVDKAVKAAH
AAFYGSWKQVSARQRGQLMLNLADLMEKHKEELATIESVDSGAVYTLALKTHIGMSIDAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLVTPWNYPLMMLSWKMAACIAA
GNTCLIKPAQTCPLTALKFAELTVKAGFPPGVINVLPGKGSDAGQAVADHQLVRKLGFTG
STPIGKHIMKSCADSNLKKCSLELGGKSPLIIFADCDLDKAVKHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFVRRVLKDLRTMTIGDPLNRSTAHGPQNHKAHFEKLLEFCERGVKDGA
TLVYGGCRVPNLKGYFFTPTVFTNVEDDMFIAQEESFGPIMIISKFNGSDIDSVMQRANS
TEYGLASGVFTKDISKALSFADRIEAGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGQEAL
NEYLKTKCVTIEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaaacttcgcattgccatcattggtcagagtaactttgctgccgatgtgctg
gagcttctgctggagcgttcgaacatacaaattgttggcgtcttcaccataccggacaag
gggagtcgcgaggatgtgctggccaccactgccgcagcccacaagatacccgtctttaag
tttagcagctggcggcggaagggcgtggctctgccggaggttttggcacaatataaatcg
gtgggcgccaccttgaatgtgctgccgtactgttcgcagttcattccaatggaggtgatt
gatggggcctcattgggaagcatttgctaccatccatcgatcctgccacgccatcgcggt
gccagtgccatatcctggaccctgattgagggcgacgaggtggctggctttagtatcttt
tgggcggatgatggcctggacactggaccattgctgttgacgcgtcagacgaatctcgag
cccaccgacacactggacagcatctacaagagattcctgtatcccgagggcgtcaaggcc
atgggtgtggccgtggacatggtggccaatggcacggctccaaagataacccaaacggag
atcggggccacctacgatccggccatgttcaaggccgataatcagttgatcaatctgcag
caaccggcggagcggatctggaactttgtgcggggcttggactccgtgcctggagccata
gccacagttctgctgcaggacggcaccgaggagcagatacgtctctttggcgcccatctg
tattccgctggtcccgtgtcgaatggccagccactgcgactgaagggtctcacgaaaccc
gcttggattcacaccttggggcttttgatcgaaggcaccgatggggcgttcgtgaacgtc
cgtcgcatcaagcgtgggtcaaaggtgatcaatgccagtgaatggtttaagcaggccgag
cagcagcccatcacagacttctccgaggatgagttatccaagaagggtatcctttctgcc
atttggcaggctattttgaaggaacccattgaggattccacagatttctttgccgctggc
gcgggctccatggatgtggtgcgtctggtggaggaagtaaaggaagccttcgatgtccca
ctcgagaatgataacgtcttcatggctcccgtgtttgaggagttctttggacagctcgtt
aaaatcctgcgacaaggcagtggcggttctggtgggcagcagctcatctacgatggtttc
actctgaaggcaaacaaaagggagattcaggtgcccacacagctcttcatcgatggggag
tttgtggatgccgagggcaagcgcactttggagattgtgaatcccacagacgagaaggtc
ctctgtaaagtggcctgtgcctctcccaaggatgtggacaaggcagtaaaggctgcccac
gctgctttctatggctcgtggaagcaggtttcggcccggcagcgtggtcaactgatgctc
aatctagctgatctcatggagaagcacaaggaggagcttgcaaccatcgaatcggtggat
tcgggtgcggtctacaccctggccctgaagacccacattggcatgtccatcgatgcctgg
cggtattttgccggatggtgcgataagatccaagggaacaccatccccgtgaaccccgcg
agacccaataacgtcctgaccttcacgcggaaggagcccattggcgtgtgtggcttggtc
accccatggaactatcctttgatgatgctctcctggaagatggccgcctgcattgctgct
ggcaatacctgtctgatcaagcccgcccaaacgtgtcctttgactgctctgaaattcgct
gagctgacagtcaaggcgggttttcctccgggtgtgattaatgtcctgcctggcaagggt
tccgatgctggtcaggcggtggccgatcatcaattggttcggaagctgggcttcacggga
tccacgcccattggcaagcatattatgaagtcctgtgcggactccaatctcaagaagtgc
tcgctagagctgggaggcaagtctcctttgattatctttgcggattgtgacctagacaaa
gcggtgaagcatggcatgtcttctgttttcttcaacaagggagaaaattgcattgctgct
ggccgactctttgtggaggatcgcattcatgacgagtttgtgcggcgtgtgctcaaggat
ctccgcaccatgaccattggggatcccctgaatcgctctacagcccatggcccgcagaac
cacaaggcacactttgagaagctgctggagttctgtgaacgaggtgtgaaggacggggcc
acactggtgtacggcggctgtcgtgttccgaatctcaagggctacttctttactcccacg
gtgttcacgaatgtcgaggatgatatgttcatagcgcaggaggagtcctttgggcccatc
atgatcatctccaagttcaatggcagcgacatcgactcggtcatgcagagggccaacagc
acggagtacggactggccagcggtgtctttaccaaggacattagcaaggctctcagcttc
gcggaccgcattgaggccggcaccgtgtttgtgaatgtctacaacaagacagacgtggca
gcgccatttggcggcttcaagcagagcggctatggcaaggacctgggtcaagaggccctc
aacgagtacctcaagaccaagtgtgtgacaattgaatattga

DBGET integrated database retrieval system