KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21309Help
Entry
Dpse_GA21309      CDS       T01032                                 

Definition
GA21309 gene product from transcript GA21309-RB (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dpse_GA21309
   00330 Arginine and proline metabolism
    Dpse_GA21309
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dpse_GA21309
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Dpse_GA21309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 719 aa AA seqDB search
MFKGVPALASQNLRFLRSHTEQAATAGLGLGLAKRSKASSVELAAAEPTDVHSPGESNLL
NRVKFGHTGQQVKQKITTEKKLRAPPLMNLVFANRKLSFYDTSSGRNEENAKLNQRRHYS
MRPHREQEQRNAEDVLFDMFASEETGLISMGKFLNGLKTTGIRRNDPRVRELMDNLKKVH
KLNNYETGSSAETQHLNRETFKAVVAPNIVLIAKAFRQQFIIPDFSSFVKDIEEIYCRCK
TNTLGKIADYIPQLTRYCPESWGVSICTVDGQRFSIGDVEEPFTLQSCSKPLTYAIALEK
LGPKVVHSYVGQEPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIF
DYTMSWFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDYYF
QCCAMETNCEAMSVIAASMANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFK
VGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDDLGNTVRGVQFCEELVNMFNFHRYDNLKH
LSNKKDPRKHRYETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLADYDGRTALHLASS
EGHLECVKFLLEQCHVPHNPKDRWGNLPVDEAENFGHSDVVEYLKSWAEKTVAAPECTPE
AVTTKTEADEELCSTSDLDRSPNSSPIPTESGSGHSSPAPSEAGSTVSIASDDKTKPGL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaggtgttcccgctctagcaagccagaatcttcgcttcctgaggagccacacg
gagcaggcagccaccgctggcctgggcctgggcctggcgaaacgctcaaaggcatcgtct
gtggaactggccgcggcagaaccgactgatgtccactctcctggggagtcgaacctgctg
aatcgcgtcaagtttggccatacgggccagcaagtgaagcagaaaataactactgagaag
aaactgcgcgctccgccgcttatgaatctggtgtttgccaaccgcaagctatccttctac
gacaccagctccggacgcaacgaggagaatgcgaaactcaatcagcgacgccactattcg
atgcggccccaccgggagcaggagcagcgcaatgccgaggatgtgctgttcgatatgttt
gccagcgaggagaccggcctgatctcgatgggcaagttcctgaacggactgaagaccacc
ggcatcaggcggaatgatccacgggtgcgcgagctgatggacaacctaaagaaggtacac
aagctgaacaactacgagacgggatcctcggccgagacgcagcacctcaaccgggagacc
tttaaggccgtggtggctcccaatatcgtactaattgcgaaggcattccgacagcaattc
atcatccccgacttctcgagcttcgtcaaggacatcgaggagatctactgtcgctgcaag
accaacaccctgggcaaaatcgccgactacattccgcagctgactcgctactgtcccgaa
tcgtggggcgtgagcatctgcaccgtcgacggacagcgcttctccatcggcgatgtggag
gaaccgttcacattgcaaagttgcagtaaaccgcttacctatgccatcgccctggagaag
ctcggtccaaaggtggtgcactcttacgtgggacaggagcccagcggcaggaacttcaat
gagctggtcctggaccagaacaagaagccacacaatcccatgatcaatgccggtgccatc
cttacctgctccctgatgaacgcactggtcaagcctgacatgacctcggccgagatcttc
gactacaccatgtcctggttcaagcgcttgtccggcggagagtacatcggctttaacaat
gccgtgttcctctcggagcgagaggctgctgaccgcaactatgccctcggcttctatatg
cgggagaacaagtgcttccccaagcggaccaacctgaaggaggtgatggactactatttc
cagtgctgcgccatggagaccaactgcgaggcgatgtccgtgattgcagccagcatggcc
aacggcggcatctgccccaccaccgaggagaaggttttccggccagaggtcatccgcgat
gtgctctcgatcatgcactcctgcggcacgtacgactactcgggccagtttgccttcaag
gtgggcctgccggccaagtctggcgtcagcggtggcatgatgctggtcatccccaacgta
atgggcatcttcgcctggtcgccgccactcgacgacttgggaaacacagtgcggggcgtg
cagttctgcgaggagctggtcaacatgttcaacttccatcgctacgacaacctgaagcat
ctgtccaacaagaaggatccgcgcaagcaccgctacgagaccaagggcctgtccattgtc
aacctactcttttcggcggccagcggcgatgtaacggctctgcgccggcaccgactgtcc
ggcatggacatcaccctggcagactacgacggacgcaccgccctgcacttggcctcctca
gagggccacctggagtgcgtcaagttcctgctggagcagtgccatgtgccgcacaacccc
aaggatcggtggggcaacctgcccgtcgatgaggctgagaactttggccactcggacgtg
gtagagtacctcaagtcctgggccgagaagaccgttgcagccccagagtgcacaccggag
gcggtgaccacgaaaaccgaggcggatgaggaactgtgcagcaccagcgatctcgatcgc
agtcccaactccagccccattcccactgagtctggatcgggacactccagcccggcgccc
tcggaggcgggaagtacagtaagcatcgccagcgatgacaagaccaagccgggtctctag

DBGET integrated database retrieval system