KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21348Help
Entry
Dpse_GA21348      CDS       T01032                                 

Definition
GA21348 gene product from transcript GA21348-RA (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dpo00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dpo00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dpo00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dpo00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dpo00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dpo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 655 aa AA seqDB search
MSLAVSLRRALLVLLSGAIFILTVLYWNQGGSKTQAYSEAFERPHSHKDGSSFPIPVEKF
WTYKCENDRCMRVSYHPGKTGKRVSFITCSMTCGYVNIWPAPTVKSLVSAHTTSFSVNVV
QLEQDTPHREVRKQLQLAFDCFLKDLRQIQRLDYATSPPETGESESSSWASQNDVVGAAI
SGERRPGVLESLVVKISVQKSGDVSFSLDNDESYELTAITEGHRLQVEITANSFFGARHG
LSTLQQLIWFDDEDHLLHTYVNSKVKDAPKFRYRGLMLDTSRHFFSVEAIKRTIVGMGLS
KLNRFHWHLTDAQSFPYISRNYPELAEHGAYSEGETYTEQDVREVADFAKIHGVQVIPEI
DAPAHAGNGWDWGPKRGMGELAVCINQQPWSFYCGEPPCGQLNPKNNHTYLILQRLYEEL
LQATGPTDLFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQAMARLKLANNGVAPKYLAV
WSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGSWRSTG
EAACSPYRTWQNVYKHRPWERMRLDKKRRKQVLGGEACLWTEQVDENQLDNRLWPRAGAL
GERLWSDPSDDHDLDIMAPEVFRRISLFRTRLVELGIKAEALFPKYCAQNPGECI
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtcactggccgtgtcgctgcgccgggctcttctggtgctcctctcgggcgccatcttc
atcctcaccgtgctgtactggaaccagggtggcagcaagacacaggcgtacagcgaggcg
ttcgaacgcccccacagtcacaaggacggctcctcctttcccatacccgtggagaagttt
tggacatacaaatgcgagaatgaccgatgtatgcgggtgagctatcatcctgggaagacc
ggcaaacgtgtctccttcatcacctgctcgatgacctgcgggtacgtcaacatctggcca
gcaccgaccgtcaaatcattggtcagcgcccacacaaccagcttctcggtgaatgttgtg
caactggagcaggacacaccgcatcgggaggtgcggaagcagctgcagctggcctttgac
tgtttcctcaaggatctgcgccagatccagagactggactacgctaccagtccacctgag
acgggcgaaagtgaatcctcatcgtgggcatcgcagaacgatgtggtaggagccgctatt
tctggggagaggcgaccaggtgttctggagagtctggtggtgaagatcagcgtgcaaaag
tccggagatgtcagcttcagcctggataacgatgagagctatgagctgaccgccatcacg
gaaggccaccgcctgcaggtggagatcacggcgaactcgttctttggggcccgccacggc
ctgtccacgctgcagcaactcatttggttcgacgacgaggatcacctgctgcacacgtac
gtcaacagcaaggtgaaggatgccccgaagttccgctatcgcggcctgatgctggatacc
tcacgccactttttctcggtggaggcgatcaagcgaacgatcgtgggaatgggtctgtcc
aagctgaatcgctttcactggcatctgacagatgcgcagagctttccgtatatctcgcgc
aactatccggagctggccgagcacggggcctactcggagggcgagacgtacacggagcag
gatgtgcgcgaggtggccgactttgccaagatccatggcgtgcaggtgataccggagatc
gatgcaccggcccatgccggcaatggctgggactgggggcccaagaggggcatgggcgag
ctggccgtgtgcatcaatcagcagccgtggagcttctactgcggagagccaccgtgcggg
cagctcaatccgaagaacaaccacacctacctcatcctgcagcgcctctacgaggagctg
cttcaggcgacggggcccacggacctctttcatctgggcggcgacgaggtgaatctcgac
tgctgggcccagtactttaacgacacggatctgcggggcttgtggtgcgatttcatgctg
caggcgatggccaggctgaagctggcgaataatggtgtggcccccaagtatttggccgtc
tggtcaagcgccctgaccaacaccaagtgtcttccaaatagtcaattcacggtgcaggtg
tggggcggcagcacttggcaggagaactacgaccttctggataatggatacaacgtgatc
ttctcgcacgttgatgcctggtacttggactgcggcttcggcagctggcggagcacagga
gaggccgcctgctccccctatcgcacctggcaaaacgtctacaagcatcggccctgggaa
cgcatgcgtctggacaagaagcggcgcaagcaggtattgggcggagaggcctgcctgtgg
acggagcaggtggacgagaatcagctggacaatcggctgtggccccgtgccggtgccctg
ggcgagcgcctgtggtcggatcccagcgatgatcatgatctggatattatggccccggag
gtgttccgccgcatctcgctgtttcgcacccgtctcgtcgagctaggaatcaaggcggag
gccctgttccccaaatattgtgcccagaatcctggcgaatgcatttga

DBGET integrated database retrieval system