KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21380Help
Entry
Dpse_GA21380      CDS       T01032                                 

Definition
GA21380 gene product from transcript GA21380-RA (EC:3.4.21.-)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     Dpse_GA21380
Peptidases [BR:dpo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dpse_GA21380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 276 aa AA seqDB search
MKLFLAVLALAFACASALPQKADPVPLKDAVLGSSPGSIEGRITNGYPAYEGKVPYVVGL
GFSKSGSGWWCGGSIIGNTWVVTAAHCTHGADSVTIYYGALWRLQAQYTHTVHSGSFRQH
SNYNTNNLNNDISLINTPHVDFWHLVNKVELPSYNDRYNTYSGWWALASGWGRTSDNSGV
SDYLNCVDSQIIDRSACSSVYGTDVITDHVICTSTPDGKSTCSGDSGGPLVLHEGSKLVG
VTSFVASNGCTSGLPDGFTRVTSYLDWIRDHTGISY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttcctagctgtcctggccctggcctttgcctgcgcttcagctttgccgcag
aaggccgatcctgtgccactgaaggacgcagtcctcggctcgtcccctggctccattgaa
ggtcgtattaccaatggttatcctgcctacgaaggaaaggtgccctacgtcgttggcctg
ggcttcagcaaaagcggcagcggctggtggtgcggtggatccatcatcggcaacacctgg
gtggttacggccgctcactgcacccacggtgccgactccgtgaccatctactacggcgcc
ctgtggcgcctgcaggcccagtacacccacaccgtgcacagcggcagcttcagacagcac
tctaactacaacaccaacaacctgaacaacgacatctcactgatcaacaccccacacgtg
gacttctggcacctggtcaacaaggtggagctgcccagctacaacgaccgctacaacacc
tactccggatggtgggctctggcctccggctggggcaggacatccgacaacagcggcgtg
tctgactacttgaactgcgtcgactcccagatcattgaccgttctgcctgctcgagcgtg
tacggtactgatgtgatcaccgaccacgtcatttgcacctcgactcccgatggcaagtca
acctgttccggcgactctggtggccctctggtcctccacgaaggcagcaaactggttggt
gtcacctccttcgtggcctccaacggatgcacctccggtcttcctgatggtttcacccgt
gtcaccagctacctggactggatccgcgaccacaccggcatctcctactaa

DBGET integrated database retrieval system