KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21380Help
Entry
Dpse_GA21380      CDS       T01032                                 

Definition
(RefSeq) GA21380 gene product from transcript GA21380-RA (EC:3.4.21.-)
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 296 aa AA seqDB search
MPLYKSLSGLLLFSCAKLSNMKLFLAVLALAFACASALPQKADPVPLKDAVLGSSPGSIE
GRITNGYPAYEGKVPYVVGLGFSKSGSGWWCGGSIIGNTWVVTAAHCTHGADSVTIYYGA
LWRLQAQYTHTVHSGSFRQHSNYNTNNLNNDISLINTPHVDFWHLVNKVELPSYNDRYNT
YSGWWALASGWGRTSDNSGVSDYLNCVDSQIIDRSACSSVYGTDVITDHVICTSTPDGKS
TCSGDSGGPLVLHEGSKLVGVTSFVASNGCTSGLPDGFTRVTSYLDWIRDHTGISY
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcccctatataaatcattgtcgggactgctattattcagttgtgctaaattgtccaac
atgaaactgttcctagctgtcctggccctggcctttgcctgcgcttcagctttgccgcag
aaggccgatcctgtgccactgaaggacgcagtcctcggctcgtcccctggctccattgaa
ggtcgtattaccaatggttatcctgcctacgaaggaaaggtgccctacgtcgttggcctg
ggcttcagcaaaagcggcagcggctggtggtgcggtggatccatcatcggcaacacctgg
gtggttacggccgctcactgcacccacggtgccgactccgtgaccatctactacggcgcc
ctgtggcgcctgcaggcccagtacacccacaccgtgcacagcggcagcttcagacagcac
tctaactacaacaccaacaacctgaacaacgacatctcactgatcaacaccccacacgtg
gacttctggcacctggtcaacaaggtggagctgcccagctacaacgaccgctacaacacc
tactccggatggtgggctctggcctccggctggggcaggacatccgacaacagcggcgtg
tctgactacttgaactgcgtcgactcccagatcattgaccgttctgcctgctcgagcgtg
tacggtactgatgtgatcaccgaccacgtcatttgcacctcgactcccgatggcaagtca
acctgttccggcgactctggtggccctctggtcctccacgaaggcagcaaactggttggt
gtcacctccttcgtggcctccaacggatgcacctccggtcttcctgatggtttcacccgt
gtcaccagctacctggactggatccgcgaccacaccggcatctcctactaa

DBGET integrated database retrieval system