KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21476Help
Entry
Dpse_GA21476      CDS       T01032                                 

Definition
GA21476 gene product from transcript GA21476-RA
Orthology
K04646  
clathrin heavy chain
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dpse_GA21476
   04142 Lysosome
    Dpse_GA21476
Exosome [BR:dpo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dpse_GA21476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1584 aa AA seqDB search
MTQPLPIRFQEHLQLTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDSTN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNATQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIDGNKEPTTLFCFAVRTATGGKLHIIEVGTPPNGN
QAFPKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHEASGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGA
EDLFVRKFNKLFTAGQFAEAAKVAALAPKAILRTPQTIQRFQQVQTPAGSTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKASDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYIFLLRSVMRSNPEQGAGFASMLVAE
EEPLADINQTVDIFMEHSMVQQCTAFLLDALKHNRPAEGSLQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTTKALIDLFESFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERFLKENQY
YDSRVVGRYCEKRDPHLACVAYERGQCDRELIAVCNENSLFKSEARYLVARRDAELWAEV
LSEANPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLDNYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYVD
VVDVASKVESWDDLVRYLQMARKKARESYIESELIYAFARTARLADLEEFISGPNHADIQ
KIGDRCFSDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFDELIALLESALGLERAHMGMFTE
LAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMI
AHPTEAWREGHFKDIVTKVANIELYYKAIEFYLDFKPLLLNDMILVLAPRMDHTRAVSYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDNIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDKLYKDAMEYAAESGKQEIAEELLGWFLE
RNAHDCFAACLYQVGETTLQSIKP
NT seq 4755 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgctacccatccgctttcaggagcatttacagctcacaaacgttgggatc
aacgcaaactcgttctcattcagcacgctcacgatggagtcggacaagtttatttgtgtg
cgcgagaaagttaatgataccgcccaagtagtcatcattgatatgaacgattcgaccaat
cccacacgacgtcccatatcagctgactcggccattatgaatccagcaagcaaagttatt
gctctcaaagcgcaaaagacgttgcagatattcaatattgaaatgaaatcaaaaatgaag
gctcacacgatgaatgaagatgttgtgttctggaaatggatatctttgaacactttagca
ttggtgaccgagacgagcgtttttcattggtctatggaaggtgactcgatgccacaaaaa
atgtttgatagacattcctcactcaatggctgtcagataatcaattatcgctgcaatgct
acacaacaatggctgcttctggtaggcatatcggcacttcccagccgcgtcgccggcgcc
atgcagttgtattccgtggagcgtaaagtatcgcaggccatcgaaggtcacgcagccagt
tttgcgacttttaaaatagacggaaacaaggaaccgactacgcttttttgctttgcagtt
cgcaccgccacaggcggcaagcttcacatcattgaagtcggaacgccgcctaatggcaac
caggcttttccaaaaaaggctgttgacgtcttctttccaccggaagcccagaacgacttt
ccagtggccatgcaggtctcagcgaagtacgataccatctatttgataaccaaatatgga
tatattcatctgtacgatatggagaccgccacatgcatatacatgaatcgcatatcggcc
gatacaattttcgtgaccgctccgcacgaggccagcggtggaattattggcgtcaaccgc
aagggtcaggtgctatctgtaactgttgacgaagagcagatcattccttatataaacact
gttttgcaaaaccctgacttggccctgcgaatggctgtacgaaacaatttagcaggagcg
gaggatctttttgtccgcaagttcaacaagctgtttactgccggtcagttcgccgaagcg
gccaaagttgctgctctggcccccaaggccattcttcgcactcctcagaccattcaacga
tttcaacaagtgcaaacaccagcaggctcgacgacgccacctctactgcagtactttggt
attctgctcgaccagggcaagttaaacaagtttgagtccctggagctgtgtcgtccagtt
ctgctgcaaggaaagaagcaactttgcgaaaaatggctaaaggaggagaaacttgagtgc
agcgaagaactaggtgatctcgttaaagcctcagacctcacgctagcgctctccatttac
ttgcgtgccaatgttcccaataaagtgattcagtgttttgcagaaactggacagtttcaa
aaaattgtgctttatgccaagaaggttaactatacaccagactacatttttctgctgcgt
tcggtgatgcgtagcaatcccgagcaaggtgctggttttgcatctatgcttgtagcagag
gaagagcctctggcggacattaatcagactgtcgatatcttcatggaacactctatggta
caacagtgcacggcttttttgttagatgcccttaagcacaatcgcccggccgagggttcg
ctgcagacgcgtttgcttgaaatgaatctcatgtctgccccacaggtggccgacgctata
cttggtaatgctatgttcacccactacgatagggcacacatcgcccagctgtgtgaaaaa
gcaggtttgttgcagcgtgctctggagcactacacagatctgtacgatataaagcgggct
gtcgtacacacgcatatgctgaatgctgagtggctggttagcttctttgggactttatcg
gtggaggactctctggaatgtctgaaggctatgttaacagcaaatctgcggcagaattta
caaatctgtgtacaaattgccaccaagtaccacgagcagttgaccaccaaggcgctaatt
gacctatttgagagctttaagagctacgacggactgttctatttcctgagcagtattgtg
aacttctcacaggatccagaggttcactttaaatacattcaagccgcctgtaagacaaac
cagataaaagaggtggaacgaatttgtcgcgaatctaactgttataacccggagcgcgtg
aagaatttcttgaaggaagctaaactgactgatcaactgccgctgattattgtttgtgat
cgttttgactttgtccatgatctggtgctttacttataccgcaacaatctccaaaagtat
atagagatctatgtgcagaaggtaaacccttctcgcttgccggttgttgtgggtggtttg
cttgacgtcgactgcagtgaggatattatcaaaaatctcatactagtggtcaagggtcag
ttctctacggatgagctggtggaggaggttgaaaagcgtaatcgcttaaagctcctactt
ccctggcttgagtctcgggtccacgaaggctgcgttgagcccgccacacacaatgccttg
gccaagatttacattgattcaaataacaacccagaacgtttcctcaaagaaaatcagtac
tacgacagccgcgtggtcggtcgctactgtgaaaagcgtgatcctcatctggcctgtgtt
gcctacgaacggggccagtgcgatcgcgaattgatcgctgtctgtaacgaaaactcacta
tttaaaagtgaagctcgttatctagtggctcgacgtgatgccgaactctgggcggaggtc
ctgtccgaagctaatccatacaagcgccagttgattgatcaagtcgttcagacggcactg
tctgaaacacaggatcccgacgatatttcggtaacagtaaaggcatttatgactgctgac
ttgccgaatgagctgattgagctgctggaaaagatcatattggactcttcggtgttcagc
gaccatcgcaatcttcagaatctgctcatactcactgctattaaagctgatcgtacacgc
gttatggattatataaaccgactggacaattacgatgcacccgatatagccaacattgcg
attagtaatcaattgtatgaggaggcatttgccatattcaagaagttcgatgttaatacg
tcagccattcaggtgctcattgatcaggtcaacaatttggagagagccaacgagttcgcc
gagcgctgtaacgagccagccgtatggtcacagttagccaaagctcaactacagcagggt
ttagtgaaggaggctattgattcatatataaaggccgatgatccgagtgcttacgtggac
gtggttgacgtggctagtaaggtggaatcgtgggacgaccttgttcggtatcttcaaatg
gcacgtaaaaaagcgcgtgagtcctatattgagagtgaattaatttacgcttttgctcgc
actgctcgtttggccgatctcgaagagttcatatcgggtcccaaccacgcagacatacag
aaaattggagatcgctgtttcagtgacggaatgtacgatgctgcaaagctcctatataat
aatgtcagcaactttgcccgtttggctattacactggtatatcttaaggagtttcagggt
gctgttgactcggcgcgaaaggctaactcgacgcgcacatggaaggaagtttgttttgct
tgcgtagatgctgaagaatttcggctagcgcagatgtgtggcctacatattgttgttcat
gctgatgagctagaggatttgattaattattaccagaatcggggatatttcgatgagctg
atagcactacttgagtctgctctgggcctagagcgtgcgcatatgggaatgtttactgag
ttggccatactctactcaaaatttaaaccatcaaaaatgcgagaacacctagaactattc
tggtcccgcgttaacataccaaaagttctgcgagctgccgagtccgctcatctctggtcg
gagctagtgttcctttacgataagtatgaggaatatgacaacgctgtgctggccatgatt
gctcacccgactgaggcatggcgcgagggacactttaaggacatcgtaacaaaggtggca
aatattgagttgtactacaaggccatcgaattttatttagactttaagccgttgctgctg
aacgatatgattttagtgctggctccccgaatggatcatactcgagctgttagctacttt
tccaagaccggctacttgccgttggtcaagccctatttgcgctccgtacaatcccttaat
aataaagctatcaatgaagctcttaatggtctcttaatcgacgaggaggactaccaaggt
ctacgcaattcgatcgatggtttcgacaactttgacaacattgcgctggctcagaagctt
gagaagcatgagctcacagagtttcgtagaattgctgcatacttgtataaaggaaataac
cgttggaaacaaagcgttgagctgtgtaaaaaggataaactttacaaggatgccatggag
tatgccgctgagtctggaaagcaagagattgctgaagagttgttgggatggttccttgag
cggaatgcacacgattgctttgcggcatgtctttatcaggtgggagaaacaacattgcag
tccataaaaccctaa

DBGET integrated database retrieval system