KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21663Help
Entry
Dpse_GA21663      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10739  
replication factor A2
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dpse_GA21663
   03420 Nucleotide excision repair
    Dpse_GA21663
   03430 Mismatch repair
    Dpse_GA21663
   03440 Homologous recombination
    Dpse_GA21663
   03460 Fanconi anemia pathway
    Dpse_GA21663
DNA replication proteins [BR:dpo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dpse_GA21663
DNA repair and recombination proteins [BR:dpo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dpse_GA21663
   MMR (mismatch exicision repair)
     Dpse_GA21663
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dpse_GA21663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
4
AA seq 237 aa AA seqDB search
MNDSFGDFNATQTAPAGAASNQKGEGIVPLFIKQIVDAPEGNIELFGMQFGMACLVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLNNYVKVYGTTRSQAGQKSLMV
FKLLPVLDPNEVCTHLLEALNARYKAEDYQNKGGSSAMVPDFTASQSTAIVNGLDPKQQA
VFQAIKSNMSEEGINRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcgtttggtgatttcaatgccacacagacggcaccggcgggcgccgccagc
aatcaaaaaggagagggaattgtgcctttgtttataaagcagattgtggatgcgcccgaa
gggaatattgagctgttcggcatgcaatttggcatggcgtgtctggtggcaatcgttcgg
aatgtggagacctcttccaccaagataacctatacgctggaggaccacagtggtcggatc
gatgcccactactggctggaggagggcgacgccctcaaggcaccggaagtgatgctaaac
aactacgtcaaggtctatggcaccacacgctcgcaggcgggccagaaatcgctgatggta
ttcaagctgctgcccgtcctggatcccaatgaggtgtgcacccacctacttgaggctctg
aatgcccgctacaaggcggaggattaccagaacaagggaggttcgtctgccatggtccct
gatttcaccgcctctcagagcacggccattgtgaatgggctggatcccaagcagcaggcg
gtgttccaggccatcaagagcaacatgtccgaggagggaatcaatcgaaaggagctgaag
gccaagttttcgcacattagtgattccgaattgaccaacattttggattttatgatttcg
gagggccatatctactcgagcatagatgctgatcattttatttgcaccatgtaa

DBGET integrated database retrieval system