KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21663Help
Entry
Dpse_GA21663      CDS       T01032                                 

Definition
(RefSeq) GA21663 gene product from transcript GA21663-RA
  KO
K10739  
replication factor A2
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dpse_GA21663
   03420 Nucleotide excision repair
    Dpse_GA21663
   03430 Mismatch repair
    Dpse_GA21663
   03440 Homologous recombination
    Dpse_GA21663
   03460 Fanconi anemia pathway
    Dpse_GA21663
DNA replication proteins [BR:dpo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dpse_GA21663
DNA repair and recombination proteins [BR:dpo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dpse_GA21663
   MMR (mismatch exicision repair)
     Dpse_GA21663
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dpse_GA21663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 237 aa AA seqDB search
MNDSFGDFNATQTAPAGAASNQKGEGIVPLFIKQIVDAPEGNIELFGMQFGMACLVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLNNYVKVYGTTRSQAGQKSLMV
FKLLPVLDPNEVCTHLLEALNARYKAEDYQNKGGSSAMVPDFTASQSTAIVNGLDPKQQA
VFQAIKSNMSEEGINRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcgtttggtgatttcaatgccacacagacggcaccggcgggcgccgccagc
aatcaaaaaggagagggaattgtgcctttgtttataaagcagattgtggatgcgcccgaa
gggaatattgagctgttcggcatgcaatttggcatggcgtgtctggtggcaatcgttcgg
aatgtggagacctcttccaccaagataacctatacgctggaggaccacagtggtcggatc
gatgcccactactggctggaggagggcgacgccctcaaggcaccggaagtgatgctaaac
aactacgtcaaggtctatggcaccacacgctcgcaggcgggccagaaatcgctgatggta
ttcaagctgctgcccgtcctggatcccaatgaggtgtgcacccacctacttgaggctctg
aatgcccgctacaaggcggaggattaccagaacaagggaggttcgtctgccatggtccct
gatttcaccgcctctcagagcacggccattgtgaatgggctggatcccaagcagcaggcg
gtgttccaggccatcaagagcaacatgtccgaggagggaatcaatcgaaaggagctgaag
gccaagttttcgcacattagtgattccgaattgaccaacattttggattttatgatttcg
gagggccatatctactcgagcatagatgctgatcattttatttgcaccatgtaa

DBGET integrated database retrieval system