KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21683Help
Entry
Dpse_GA21683      CDS       T01032                                 

Definition
GA21683 gene product from transcript GA21683-RA
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dpse_GA21683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 510 aa AA seqDB search
MWISGHLVLLLLVALVAAKTKTSAVQEDVSEYKDFKKLLRTKNNVLALYVTSAKAAGTEL
RVFREAAEAIRGTGTMLLVDCGQQDRKKLCKKLKISPDRYTLKHYKDGDYHKDYDRQVSV
GSIVTFMRDPSGDLPWEEDADGNDVLHFSDAATFTKHLRKDIRPMLVMFYVPWCGFCKKM
KPDYGKAATELKSQGGYLLAAMNVERQENAPVRRLFNITGFPTLIYFENGKLRFTYEGEN
TKDALVAFMLNPNTKPTPKPKEPEWSADTNSEIVHLTSQGFEPALKEEKSALVMFYAPWC
GHCKRMKPEYEKAALEMKQQKVLGLLAALDATKEQPIAEKYKVKGYPTVKYFANGVYKFD
VNVREASKIVDFMRDPREPPPPPPPEKSWEEESDSKEVLFLNDETFSSTLKRKKHALVMF
YAPWCGHCKHTKPEFTAAATALQDDPRVAFAAIDCTKHSALCAKYNVRGYPTILYFSYLK
IKLDYNGGRTSKDFIAYVNNPPSTTDHTEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtggatctcaggccacctagtattgctccttctggtggcacttgttgccgctaaaacg
aaaacttctgctgtgcaggaggacgtgtccgaatacaaggactttaagaaactactgcgc
accaagaacaatgtcctggccctctatgtgaccagtgccaaggcggcgggcaccgaactg
agggtgttccgtgaggctgcagaggcgatacgaggcaccggtaccatgctgttggtggat
tgtggacagcaggataggaagaaattgtgtaaaaagctgaaaatctcaccggaccggtac
acgctcaagcactacaaagatggcgactatcacaaggattacgatcgacaggtgagtgtc
ggttccattgtcacgtttatgcgtgatccgtccggtgatctgccctgggaagaggatgct
gacggcaacgatgtgctgcacttcagtgatgctgccacattcacgaaacacctgcgcaag
gacatacgtcccatgctggttatgttctatgtgccctggtgtggcttttgcaagaaaatg
aagccggactacggcaaggcggccacagagctcaagtcccagggtggctatctgctggca
gccatgaatgtggaacgccaggagaatgcccccgtgcgcagactttttaacataacagga
ttccccacattgatctactttgagaacggcaagcttcgctttacctacgagggtgagaac
accaaggatgccttggtggcgttcatgctaaatcccaacacaaagcccacgcccaagccc
aaggaacccgaatggtcagcggataccaactcggaaatagttcatctcaccagccagggc
tttgagcccgcattgaaagaagagaagtccgccttagttatgttctatgcaccctggtgc
ggccactgcaagcgcatgaaacccgagtatgaaaaggcagcgctggagatgaagcagcaa
aaggtgctcggtttattggccgccttggatgccaccaaagagcaaccgattgccgagaag
tacaaggtcaagggatacccaacggtcaagtactttgcgaatggcgtctacaagtttgat
gtcaatgtgcgggaagcatcgaaaattgttgattttatgcgggatcccagggagccgccg
ccgccaccaccgccggagaagagctgggaggaggaaagtgatagcaaagaggtgctcttt
ctcaatgacgagaccttcagctcgacgctaaagcgcaagaagcatgcgctggtcatgttc
tacgccccctggtgtggacactgtaagcacacaaagccagagtttactgcggccgccaca
gcgctgcaggacgatccacgcgttgcatttgccgccattgactgtaccaagcattccgca
ctctgtgccaaatacaatgtccgtggatatccaactattttgtatttctcctacctcaag
atcaagctagactacaatggtggacgcaccagcaaggactttattgcctacgtgaacaat
ccgccgagcacaacggaccacaccgagctgtga

DBGET integrated database retrieval system