KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21820Help
Entry
Dpse_GA21820      CDS       T01032                                 

Gene name
Dpse_Ugt37b1
Definition
GA21820 gene product from transcript GA21820-RA (EC:2.4.1.-)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dpse_GA21820 (Dpse_Ugt37b1)
   00053 Ascorbate and aldarate metabolism
    Dpse_GA21820 (Dpse_Ugt37b1)
   00500 Starch and sucrose metabolism
    Dpse_GA21820 (Dpse_Ugt37b1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dpse_GA21820 (Dpse_Ugt37b1)
   00860 Porphyrin and chlorophyll metabolism
    Dpse_GA21820 (Dpse_Ugt37b1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dpse_GA21820 (Dpse_Ugt37b1)
   00982 Drug metabolism - cytochrome P450
    Dpse_GA21820 (Dpse_Ugt37b1)
   00983 Drug metabolism - other enzymes
    Dpse_GA21820 (Dpse_Ugt37b1)
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dpse_GA21820 (Dpse_Ugt37b1)
Glycosyltransferases [BR:dpo01003]
 Others
  Hydrophobic molecule
   Dpse_GA21820 (Dpse_Ugt37b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 540 aa AA seqDB search
MAVHSNSIPFLLVLALVASGSQGANILGLFTSLSPSHLVIQMSMAKILAESGHNVTVVTA
LKPPLLHPAVNHIQVPLDEADGKSFGALVADMAKRDTSNAVISMLVAMGSLTSAFGKMAD
VLRHQKVKDLYEHTDNHFDLVIVGYFMNSLQLSVAHKLKVPQIVALSNPPSLLGSVLGNP
SEISYVPSMNLIVKRGQPMTFVQRVQNIFATMGSWIFMRVIEHNNDKIYKELYGDDPSMP
RYEDLYKNISLILFSSHGISEGPIRPNVPAVIEVGGIQVKDQPDPLPENIEDFLNSASSD
DGAIFLSLGSNVKAEHIKSDTVQKMFNVISKLKQKVIWKWDNLENTPGKSENILYAKWLP
QDDILAHPKIRLFITHAGKGGVTEAQYHGKPMLALPVFGDQPGNAAALVTEGFGLSLSLL
TLEEQSFRDTIHEILENPKYNRAVKAFSSLYRDRPLSARQTLLYWVDYVIRHHGAAHLQS
PVVHMGFIAAYNLDIYALLLALLFIIYLCSKLVFCALYRKLFSNKSTSHPKQKSKKQKKQ
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggccgtacattcgaatagcattccattcctcctcgtattggctttggtggccagcggg
agccagggagccaatattctgggacttttcaccagcttgagcccctcgcatttggtcatt
cagatgtcgatggccaagattctggccgagagtggacacaatgtgacagtggtcactgct
ctgaagccgcctcttctgcatccggcagtcaatcacattcaggtgccgctcgatgaggcg
gacggcaagtcctttggcgcccttgtggcggacatggccaagagggacaccagcaatgca
gtcatttccatgctcgtggcgatgggatcattgacctcggcctttggcaaaatggcggat
gtcttgaggcaccagaaagtgaaggatctgtacgagcataccgacaatcacttcgatttg
gtgatcgtgggatactttatgaacagcctgcagctttcggtagcccacaagttgaaggtg
ccacagatagtggcactctccaatccaccatcactgttgggctctgtcttgggtaatccc
tcggagatttcctatgtgccatccatgaatctcattgtgaaaagaggtcaaccgatgacc
tttgtccaacgtgtgcagaacatatttgctacgatgggaagttggatatttatgcgtgtg
attgagcataataatgacaagatttacaaagagctctatggcgacgatccctcgatgccc
cgatatgaggatctgtacaaaaacatctccctgatactcttctcttctcatggcatcagt
gagggacccatccgacccaatgttcctgctgtgatcgaagtgggaggcatccaggtcaag
gatcagccagatcctctccccgaaaacatagaagacttcctgaacagcgcctctagtgat
gacggagccatcttcctgagtctcggctccaacgtgaaggcagaacacatcaagtccgac
accgtgcaaaagatgttcaatgtcatctcgaaactaaagcaaaaggtcatctggaagtgg
gacaatctggagaatacccctggcaaatcggagaatatactctacgccaagtggctgccg
caggacgatatcctggcgcatcccaagatcaggctcttcatcacacacgcgggcaaggga
ggcgtcaccgaggcccagtaccatggaaagcccatgctcgctcttcccgtgtttggcgat
cagccaggaaatgctgcggcattggtcaccgagggctttgggctcagtctcagtctcctg
accctcgaggagcagtccttccgcgacactatccacgagatcctggagaatcccaagtac
aatcgagcagtaaaagctttctcctccctctaccgcgatcgtcccctgagcgcacgtcaa
acgctcctctattgggtggactatgtcatccgccaccatggtgccgcacatctccagagt
cccgtggtgcacatgggattcatagcagcctataatttggatatttatgccttacttttg
gcattactatttattatttatttgtgtagcaaactagtgttttgtgccctttataggaaa
cttttttcaaacaaatctacaagtcatccaaaacaaaaaagcaaaaagcaaaaaaagcaa
taa

DBGET integrated database retrieval system