KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21822Help
Entry
Dpse_GA21822      CDS       T01032                                 

Definition
GA21822 gene product from transcript GA21822-RA (EC:2.4.1.25 3.2.1.33)
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dpo00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 1617 aa AA seqDB search
MLCYNKEEKKNNPGNQKKKRKYSDRSSSSNSGRMKQQLSPAKQRKQNQIQSRLVQWEMQA
VLLFVSPYQIEPPATMSTMGEDTESHSIPISEGQNAEHVLYRLKRGTRLDVHPDASLLGK
KIVLYTNYPAEGQKFVRTDYRVLGWQLKNGKQITTVMHPEAHVVDTDIHSQLQLKLSGTY
HFYFRYVERADTGSAGADGALYVQVEPTLHVGPPGAQKTIPLNSVRCQTVLTKLLGPLSS
WEPKLRVAKEAGYNVIHFTPIQELGGSRSAYSLRDQLKVNPSFASKKGDKVTFQDVEKII
KKCRQEWGVASICDIVLNHTANESEWLLQHPDATYSCASCPYLRPAFLLDAALAQCGADI
AAGSLEHVGVPLVIDQECHLEALKYQLHNAYLSKVNIHELYQCDVMQYVNNFMNQVRTRE
PPKNVANESRFQEIQLIQDPAYRRLGSTINFELALEIFNAFHGDCFDEESRFRKCAETLR
HHLDGLNDRVRAEIQGYLNYAVDNCLAGIRYERVQGDGPRVREISEKHSVFMTYFTHTGT
LGKTLPEIEADMYTKPGEFFMAHNGWVMGSSDPLLDFAEEQPGRANVYLKRELIAWGDSV
KLRFGKRPEDSPYLWKHMTEYVETTARIFDGVRLDNCHSTPLHVAEYLLDAARKINPELY
VVAELFTNSDGTDNVFVNRLGITSLIREALSAWDSHEQGRLVYRYGGAPVGGFYPNPTRH
EASSVAHALFMDLTHDNPSAVEKRSVYDLLPSSALVSMACCATGSNRGYDELVPHHIHVV
DEQRLYQEWGKGVDSKSGIMGAKRALNLLHGQLAEEGFTQVYVDQMDPNVVAVTRHSPIT
HQSVILVAHTAFGYPNPNAGPTGIGPLRFDGVLDEIILEASLTMKSDKPFDRPAPFKKDP
NVLNGFTQFELSLQEHIPLSKSTVFQTHANVDGNNTVLNFVNLRPGTVVAIRVSMHPGPR
ISFDRLQKLTNALRLGSGAEWSELQGIVSKLDLVALSAALFQCDDEERAQGTGGSAYDIP
NFGRIVYCGLQGFVSLLTEISPHNDLGHPLCTNLRDGNWMMDYMADRLTNFEDLKPLSVW
LKAAFEPLKNIPRYLIPCYFDAIVSGVYNVLLNQVNELMPDFIKNGHSFTQSLALSTLQF
LSVCKSANLPGFSHAINPPKPPKQCVTLSAGLPHFSTGYMRCWGRDTFIALRGSMFLTGR
FNEARYIIIGFGQTLRHGLIPNLLDSGSKPRYNCRDAVWWWMYSIRQYVEEAPKGSEILK
DKVSRLFPYDDADAHAPGAFDQLLIDVMQEALQVHFQGLQYRERNAGREIDEHMVDQGFN
NHIGVHPETGFVFGGNNFNAGTWMDKMGSSQKAGNKGRPSTPRDGSAVELIGLQYSVLRF
MQGLAEKEAIPYTGVDRKGPSGELTKWSYKEWADRIKDNFDRHFFVPESETCSLANKRFI
YKDSYGATQSWTDYQLRCNFPITLTVASELCNPQNAWRALELAKQYLLGPLGMKTLDPED
WNYRANYDNSNDSTDCTVAHGSNYHQGPEWVWPIGFYLRARLIFAKKCGHLDETIAETWA
ILRAHLREMQTSHWRGLPELTNDNGSYCGDSCRTQAWSVAAILEVLYDLHALGADVA
NT seq 4854 nt NT seq  +upstreamnt  +downstreamnt
atgctctgttacaacaaagaggagaagaagaacaacccggggaaccagaagaagaagaga
aagtacagcgacagaagcagcagcagcaacagcggcagaatgaagcaacagttgtcgccg
gcaaaacaacgaaaacaaaaccagattcagtcgcgattagtgcaatgggaaatgcaggca
gtgcttctattcgtgagcccgtatcaaatcgaaccacccgccacaatgagtaccatgggc
gaagatacggaatcgcacagcatacccataagtgaaggacagaacgctgagcatgtgctg
taccgcctgaagcggggcacccggctggacgtgcacccggacgcctcgttgctgggaaag
aagatcgtcctgtacactaactatcccgccgagggccagaagttcgtgcgcaccgactac
cgtgtcctgggatggcagctgaaaaatggcaaacagatcacgactgtcatgcatccggag
gctcatgtggtggacacggatatccacagtcagctgcagctgaaactgtccggaacgtat
cacttctacttccgctatgttgagcgagcagacaccggaagtgcaggagccgatggggct
ctctatgtccaggtggagcccacccttcatgtggggccgccgggggcacaaaagacaata
cctctgaattcggtgcgctgccagacggtgctaaccaagctactgggaccactcagcagc
tgggagccaaagttgcgcgtggccaaggaggccggctacaatgtgattcacttcacaccc
atccaggagttgggcggctcgcgctccgcctactcgctgcgggatcagctgaaagtcaac
ccaagcttcgcaagcaagaagggcgacaaggttaccttccaggacgtggagaagatcatc
aagaagtgtcgccaggagtggggcgtggcctccatctgcgacattgtgctgaatcacacg
gccaacgagtcggagtggctgctccagcatccggatgccacctactcgtgcgcctcgtgt
ccgtacctgcggccagccttcctgctggacgccgccctggcccagtgcggagccgacatc
gctgccggcagcctggagcatgtgggcgtgcctctggttatcgatcaggagtgccatttg
gaagctttaaagtaccagttgcataacgcctacctatccaaggtcaatatacacgagctg
tatcagtgcgacgtgatgcagtatgtgaacaacttcatgaaccaggtgcgtactcgcgag
ccgcccaagaacgtggccaacgagtcgcgtttccaggagatccagctgatacaggacccg
gcatatcgacgcttgggtagcaccatcaatttcgagctggcgctggagatctttaatgct
ttccatggcgattgtttcgatgaggagtcacgcttccgcaagtgcgccgagaccctgcgc
caccacctggacggcctcaacgatcgcgtgcgggccgagatccaaggctatctgaactac
gccgtcgacaattgcctggccggcatccgatacgagcgagttcagggcgacggtcccaga
gtgcgcgaaatatcagaaaagcactctgtctttatgacctacttcacccacacgggcacc
ctgggcaagacgctgcccgagatcgaggccgatatgtacaccaagccgggcgaattcttt
atggcccacaacggctgggtcatgggctctagcgatccattgcttgactttgccgaggag
cagccgggacgtgccaatgtctacctcaagcgagagctcattgcctggggcgacagcgtg
aagctccgttttggcaagcggccagaggatagcccctacctgtggaagcacatgactgag
tatgtggagacgacggcccgcatattcgatggagtccggctggacaactgccactcgacg
ccgctgcacgtggctgagtacctgctggacgcggcgcggaagatcaaccccgaactgtat
gtggtggccgagctgttcaccaactccgatggcaccgacaatgtgttcgtcaatcgcctg
ggcatcacatccctaattcgcgaagccctttcggcctgggactcgcacgagcagggccgt
ctggtctatcggtatggcggtgcgccagtcggtggcttctatccgaatcccacgcgtcat
gaggcgtccagcgttgcacacgccctgttcatggacctcacccacgacaatccatcggcc
gtggaaaaacggtccgtctacgatctgctgccctcgtctgctctggtctccatggcctgc
tgtgccaccggcagcaatcgtggctacgacgaactggttccacatcatatccatgtcgtc
gacgaacagcgtttataccaggaatggggcaagggcgtggactccaagtccggcattatg
ggagctaagcgagcgctgaatctgctgcacggacagctggccgaagagggatttactcag
gtgtatgtggaccaaatggaccccaatgtggtggctgttacccggcattccccgatcacc
catcagtcggtcattctggtggctcacacggccttcgggtatccgaatccgaatgccgga
cctactggcatcggaccgttgcgctttgacggcgttttggacgagatcatcctggaggcc
agcctgaccatgaagagcgacaagcccttcgatcgtcccgctccctttaagaaggatccc
aatgtgttgaacggcttcacccagttcgaactgagcctgcaggagcacatcccgctcagc
aagtcgaccgtctttcagacccatgccaatgtcgatggcaacaacacggtgctgaacttt
gttaaccttcggcctggcacagtggtagccattcgagtgtccatgcatcccggaccccgc
atcagcttcgacaggctgcagaagctgacaaatgccttgcgcctgggatcgggcgctgaa
tggtcagagctgcaggggatcgtatccaaactggatttggtggcgctgagtgccgccctc
tttcaatgtgacgacgaggaacgtgcccaaggcacaggtggctccgcctacgatataccc
aactttgggcgcattgtctactgtggcctccagggctttgtttcactgctgacggagata
tcgccacacaatgatctgggccacccgctgtgcactaatttacgcgacggcaactggatg
atggattacatggccgatcgcctgaccaacttcgaggatttaaagccgctctccgtctgg
ctgaaggccgccttcgagcctctgaagaatataccacgctacctcattccctgctatttc
gatgccattgtcagcggggtctacaacgtgctccttaaccaggtcaacgaactgatgcca
gatttcattaagaacggccacagtttcactcagtccctggccctctccacgttgcagttc
ctttccgtctgcaagtccgccaatctgccaggcttcagtcatgccatcaatccaccaaag
ccaccgaaacaatgtgttacactctctgctggactgccgcatttctccactggttacatg
cgctgctggggccgtgataccttcatcgccctgcgtggatcgatgttcctgactgggcgt
ttcaacgaagctcgatacatcattattggattcggccagaccctgagacatggtctcata
cccaatctcttggacagcgggagcaagccgcgctacaactgccgcgatgccgtctggtgg
tggatgtactccatcaggcagtacgtggaggaggctcccaagggaagcgagatactgaag
gacaaggtgtcgcgcctctttccctacgacgatgccgatgcacatgcaccaggggccttc
gatcagctgctcatcgatgtgatgcaggaggcgctgcaggtgcatttccagggactgcaa
tatcgcgaacgcaacgcgggccgtgagatagatgagcatatggtggaccagggattcaac
aatcacattggagtgcatccggaaactggctttgtgtttggcggaaacaactttaatgcc
ggcacgtggatggacaagatgggctcgtcgcagaaggccggcaacaaggggcggccgagc
accccacgcgatggatccgctgtggagttgattggcctccaatattctgtattgcgcttc
atgcagggcctggccgaaaaggaggccatcccgtacacgggtgtggatcgcaaggggccg
tcaggtgagttgacaaagtggagctacaaggagtgggcagatcgcatcaaggacaacttc
gatcgccatttctttgtcccggagtcagagacatgttccttggcaaacaagaggttcatc
tacaaggacagctacggcgcaacccagagctggacagactatcagctccgttgtaacttc
cccatcacactgaccgtcgcttcggagctttgcaatccgcagaacgcctggcgtgctctg
gagctggccaagcagtacctgcttggaccactgggcatgaagacactggatcccgaggac
tggaactacagggctaactatgataactccaacgactcgacggattgcaccgttgcccat
ggatccaactaccaccagggacccgagtgggtatggcccattggcttctacctgcgggct
cgtctcatcttcgccaagaaatgcggccatctagatgaaaccattgctgagacctgggcc
attctgcgggcccatctccgtgagatgcagacctcccactggcgtggcctgcccgagctg
accaacgacaatggctcctactgcggcgactcctgccgcacccaggcctggagcgtggcc
gccattctcgaggttctctacgatctgcacgccctaggagcggacgtagcttag

DBGET integrated database retrieval system