KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21851Help
Entry
Dpse_GA21851      CDS       T01032                                 

Definition
GA21851 gene product from transcript GA21851-RA (EC:2.4.1.122)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:dpo00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 390 aa AA seqDB search
MTANSLLGRSILNEGRSNKRSFVSLIVGLIVGFCLAELFVYSTPERGEFMPYDGHRHGDV
NDAHHSHDMMELQGPEQDVGTHEHAHENATIAEKLYSEVRVLCWIMTNPTNHQKKARHVK
RTWGKRCNKLIFMSSAKDEELEAVALPIGEGRNNLWGKTKEAYKYIYEHHINDADWFLKA
DDDTYTIVENMRYMLYPYNPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVEKAL
PDPKLCKQDNTGAEDVEIGKCLENVKVLAGDSRDANGRGRFFPFVPEHHLIPAHTEKKFW
YWQYIYYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIINAPEALPAKLGVG
EVMPAPKEPVTETSSEKVSKRSAETETKTQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaatagtctgctaggacgatccatactaaatgaaggacgttcaaataaacga
tcttttgtctcgctgattgtgggcctcatcgtgggcttctgtctggccgagcttttcgtg
tactccacgccggaacgtggcgaatttatgccctacgatggtcaccggcatggcgatgtc
aacgatgcccatcacagtcatgatatgatggagctgcagggaccggaacaggatgtgggc
acccatgaacatgctcatgagaatgccaccattgcggagaagctgtacagcgaggtgcgg
gtactgtgctggatcatgaccaatccgacgaaccaccagaagaaggcgcggcacgtgaag
cgcacgtgggggaaacgctgcaataagctgatctttatgagctccgccaaggatgaggag
ctggaggctgtcgctctgcccataggcgagggccggaacaacttgtggggcaagacaaag
gaggcgtacaagtacatctatgagcaccacatcaacgacgccgactggttcctgaaggcc
gacgacgacacctacacgatagtcgagaatatgcgctatatgctgtatccgtacaacccc
gagacccctgtctattttggctgcaagttcaagccgtatgtaaagcaggggtacatgtcc
ggtggcgccggctatgtcctcagtcgcgaggcagtgcgtcgcttcgtcgagaaggcccta
cccgatcccaaattgtgcaagcaagacaacaccggtgctgaggatgtagagataggcaag
tgcctggagaatgtcaaggtgctggcaggagactcccgcgatgccaatggacggggacgg
ttctttccttttgttcccgagcaccatttgataccagcgcacacagagaagaaattttgg
tactggcagtacatctactacaaaaccgacgagggcttggattgctgctcggacaatgcc
atatcctttcactacgtctcgccaaatcaaatgtatgtcctggactatctgatttaccat
ttgcggccctatggaatcatcaatgcacccgaagctctgcccgcaaagctgggtgtggga
gaggttatgccagctccaaaagagccagtgactgaaacgtccagcgagaaggtgtcaaaa
cgatccgcggaaactgagaccaagacacagtaa

DBGET integrated database retrieval system