KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21874Help
Entry
Dpse_GA21874      CDS       T01032                                 

Definition
GA21874 gene product from transcript GA21874-RA
Orthology
K05759  
profilin
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Exosome [BR:dpo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dpse_GA21874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSAGFEITKEELAKLISGFDQQDILTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactgctcgcctcgcagtgcgtgaccaaggcg
tgcattgccggacacgatggcaacatctgggcgcagtctgctggctttgagattacaaag
gaggaactggccaaattgattagcggcttcgaccagcaggatatccttaccagcaacggt
gttacattagccggccaacggtacatttacctctcaggcacagatcgtgtggtgcgcgcc
aagcttgggcgaagtggagtccactgcatgaagacaacacaagccgtcatcgtttccatc
tacgaggatcccgtacagccccagcaggccgcttccgttgtagagaaactcggagactat
ctgattacttgcgggtactag

  All links  
No link information was found.   
DBGET integrated database retrieval system