KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21879Help
Entry
Dpse_GA21879      CDS       T01032                                 

Definition
GA21879 gene product from transcript GA21879-RA (EC:3.4.21.-)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dpse_GA21879
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dpse_GA21879
Peptidases [BR:dpo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dpse_GA21879
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA21879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 259 aa AA seqDB search
MERFQPAICLMLLLLLVGCCLAGTARRPRLDGRIVGGQATTIEAIPYQVSLQRSYHFCGG
SLIGHGWVLTAAHCTEGSAIQVSKVRIGSTRTDSGGILVGIKRVHRHPKFDTYTIDYDFS
VLELEEYDKKNVTQAFIGLPKQDAGIADGTAVLVSGWGNTQSTQEPTSILRAVTVPTVSQ
TECTKAYGSFGTITDRMLCAGLQQGGKDACQGDSGGPLVANGTLWGVVSWGYGCARPDYP
GVYSRVSAVRDWIGSVSGV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctttcagcccgccatttgcctgatgctcttgctccttctcgttggctgctgt
ctggcgggaacggcgcgtcggccacgcctcgatggacgcattgtgggcggccaggcgacg
actattgaggcgataccctaccaggtgtcgctccagcggagctatcacttttgcggcggc
tcgctgatcgggcacggatgggtcctcaccgctgcccactgcaccgagggatcggccatc
caggtgtccaaggtgcgcatcggctccacgcgcacagactctggcggcatcctggtgggg
atcaagcgcgtccatcgacatccaaagttcgacacctacaccatcgactacgacttttcc
gtgctggaattggaggagtacgacaagaagaacgtgacgcaggcatttatcgggctgccc
aagcaggatgcgggcattgcggatggcacagccgtcctggtctccggctggggtaatacc
caaagcacgcaggagccgacaagtatcctgcgggcagtgactgtgccgacagttagccag
acggagtgcaccaaggcctacggtagctttggaactatcacggatcgcatgctgtgcgcg
ggtctgcaacaaggaggcaaggatgcgtgtcagggagactccggtggtccgctggtcgcc
aatggaacgctgtggggcgtcgtttcctggggctacggctgtgcccggccagattaccca
ggcgtatactctcgagtgtcggccgttcgggattggataggatctgtaagtggagtttga

DBGET integrated database retrieval system