KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA22080Help
Entry
Dpse_GA22080      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K14298  mRNA export factor
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo03013  RNA transport
Module
dpo_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dpse_GA22080
Messenger RNA biogenesis [BR:dpo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dpse_GA22080
Chromosome and associated proteins [BR:dpo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dpse_GA22080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 4803699
NCBI-ProteinID: XP_001360375
FlyBase: FBgn0082064
UniProt: Q292B2
Position
3
AA seq 347 aa AA seqDB search
MFGATQSSNRMNDFEVASPPDDSVSALEFSPSTLPSKNFLIAGSWDSSVRCWEVEQNGAT
VPKSIKSMGGPVLDVCWSDDGTKVFMASCDKQVKLWDLGSDQVMQVAAHDGPVKTCHMVK
GPNYTCLMTGSWDKTLKFWDTRSPNPMMAINLPERCYCADVEYPMAVVGTASRGLIIYSL
QNTPSEYKRQESPLKYQHRTISIFRDKKKEPTGYALGSIEGRVAIQYVNPANPKDNFTFK
CHRSTSTSGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSDAMDQSITK
CGFNSNGQIFAYAVGYDWSKGHEYFNPGKKPQIFLRSCYEELKPRIN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtttggggccacacaatcatcgaatcgcatgaacgatttcgaggtggcatcgccgccc
gacgactctgtttcggcattggagttcagcccaagcacattgccttccaaaaacttcctg
attgccggcagctgggacagcagcgtacgttgttgggaggtggaacagaatggagcaaca
gtgccaaaatcaataaaatcaatgggcggaccagtgctcgatgtgtgctggtctgacgat
ggtacgaaagtgtttatggcgtcctgcgataaacaagtaaagctctgggacttgggatcg
gatcaagtaatgcaagtggcggctcacgatgggccagtaaaaacatgtcacatggtaaag
gggccgaactacacgtgtctgatgacaggatcctgggataaaacattgaagttttgggat
acccgatcgcccaacccaatgatggcaatcaacttacctgaacgctgctattgtgcggat
gtggagtatcccatggccgttgtgggcactgcatcgcggggcctaatcatatactcgctg
cagaatactcctagcgagtacaagcggcaggagagtccattgaaatatcagcatcgcacc
atatcgatttttagggataagaaaaaagagcccactggatacgctttgggcagtattgag
ggtcgcgtagccatccaatacgtgaatccggctaatcccaaagataacttcacgttcaag
tgtcatcgctccacaagcacctctggcttccaggacatttacgccgtaaacgacatagca
ttccatccggtgcatggcactctggtcacagtcggctctgatggcacattcagcttctgg
gataaggacgcccgtactaagctcaagtctagtgatgccatggatcagtctataaccaag
tgcggattcaattcgaatggccaaatattcgcttacgcggttggatacgattggtcgaag
ggccatgagtacttcaatccaggaaagaagccacaaattttcttgcgctcgtgctacgag
gaattaaagccaaggatcaattga

DBGET integrated database retrieval system