KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA22080Help
Entry
Dpse_GA22080      CDS       T01032                                 

Definition
GA22080 gene product from transcript GA22080-RA
Orthology
K14298  
mRNA export factor
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dpse_GA22080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 347 aa AA seqDB search
MFGATQSSNRMNDFEVASPPDDSVSALEFSPSTLPSKNFLIAGSWDSSVRCWEVEQNGAT
VPKSIKSMGGPVLDVCWSDDGTKVFMASCDKQVKLWDLGSDQVMQVAAHDGPVKTCHMVK
GPNYTCLMTGSWDKTLKFWDTRSPNPMMAINLPERCYCADVEYPMAVVGTASRGLIIYSL
QNTPSEYKRQESPLKYQHRTISIFRDKKKEPTGYALGSIEGRVAIQYVNPANPKDNFTFK
CHRSTSTSGFQDIYAVNDIAFHPVHGTLVTVGSDGTFSFWDKDARTKLKSSDAMDQSITK
CGFNSNGQIFAYAVGYDWSKGHEYFNPGKKPQIFLRSCYEELKPRIN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtttggggccacacaatcatcgaatcgcatgaacgatttcgaggtggcatcgccgccc
gacgactctgtttcggcattggagttcagcccaagcacattgccttccaaaaacttcctg
attgccggcagctgggacagcagcgtacgttgttgggaggtggaacagaatggagcaaca
gtgccaaaatcaataaaatcaatgggcggaccagtgctcgatgtgtgctggtctgacgat
ggtacgaaagtgtttatggcgtcctgcgataaacaagtaaagctctgggacttgggatcg
gatcaagtaatgcaagtggcggctcacgatgggccagtaaaaacatgtcacatggtaaag
gggccgaactacacgtgtctgatgacaggatcctgggataaaacattgaagttttgggat
acccgatcgcccaacccaatgatggcaatcaacttacctgaacgctgctattgtgcggat
gtggagtatcccatggccgttgtgggcactgcatcgcggggcctaatcatatactcgctg
cagaatactcctagcgagtacaagcggcaggagagtccattgaaatatcagcatcgcacc
atatcgatttttagggataagaaaaaagagcccactggatacgctttgggcagtattgag
ggtcgcgtagccatccaatacgtgaatccggctaatcccaaagataacttcacgttcaag
tgtcatcgctccacaagcacctctggcttccaggacatttacgccgtaaacgacatagca
ttccatccggtgcatggcactctggtcacagtcggctctgatggcacattcagcttctgg
gataaggacgcccgtactaagctcaagtctagtgatgccatggatcagtctataaccaag
tgcggattcaattcgaatggccaaatattcgcttacgcggttggatacgattggtcgaag
ggccatgagtacttcaatccaggaaagaagccacaaattttcttgcgctcgtgctacgag
gaattaaagccaaggatcaattga

DBGET integrated database retrieval system