KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA22553Help
Entry
Dpse_GA22553      CDS       T01032                                 

Definition
GA22553 gene product from transcript GA22553-RA (EC:3.1.26.5)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dpo03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:dpo03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 192 aa AA seqDB search
MESNAPELGAKPRTNNRNSHSRRNQSDSANHRVVRKLPPRADNDRCNIYITSKTDFKAQQ
RRCEELLNSGVKEIFLHCMGYSITRGLNLALRLIKNSEGALGYTINTSTIQLVDELHPLC
DEDDITFRQRNNSALHIKIFSNNLFNIDVPRLPAQPALPKVSQREPPKPHQQQQQQQPQK
AKAKKQTTRSQK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaatgcgcctgagctcggggccaagccaagaaccaacaatagaaacagccac
tcaaggcgaaaccagagcgacagtgccaatcacagagtggttcgcaagctaccgcctcgt
gctgacaacgaccgctgcaacatctacattaccagcaaaacagacttcaaggcacagcag
aggcgatgcgaggaactgctcaattcgggcgttaaggagatattcttgcattgcatggga
tactcgatcactcgcggccttaacttagccctgcgtcttatcaagaactcggagggtgcc
ttgggctacaccatcaacacctccaccatacagttggtggacgaactgcatccgctttgt
gatgaggacgatataacctttcggcagcgaaacaactctgctctgcacatcaagatcttc
agcaacaacctatttaatattgatgtgccccggcttccggctcagcctgctctaccaaag
gtcagccaacgcgagccgccaaagccccaccagcagcagcaacagcagcaaccacagaag
gctaaggccaagaagcagacgaccaggtcgcaaaagtaa

DBGET integrated database retrieval system