KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA22553Help
Entry
Dpse_GA22553      CDS       T01032                                 

Definition
GA22553 gene product from transcript GA22553-RA (EC:3.1.26.5)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dpse_GA22553
   03008 Ribosome biogenesis in eukaryotes
    Dpse_GA22553
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Dpse_GA22553
Ribosome biogenesis [BR:dpo03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Dpse_GA22553
Transfer RNA biogenesis [BR:dpo03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Dpse_GA22553
Mitochondrial biogenesis [BR:dpo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Dpse_GA22553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 192 aa AA seqDB search
MESNAPELGAKPRTNNRNSHSRRNQSDSANHRVVRKLPPRADNDRCNIYITSKTDFKAQQ
RRCEELLNSGVKEIFLHCMGYSITRGLNLALRLIKNSEGALGYTINTSTIQLVDELHPLC
DEDDITFRQRNNSALHIKIFSNNLFNIDVPRLPAQPALPKVSQREPPKPHQQQQQQQPQK
AKAKKQTTRSQK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaatgcgcctgagctcggggccaagccaagaaccaacaatagaaacagccac
tcaaggcgaaaccagagcgacagtgccaatcacagagtggttcgcaagctaccgcctcgt
gctgacaacgaccgctgcaacatctacattaccagcaaaacagacttcaaggcacagcag
aggcgatgcgaggaactgctcaattcgggcgttaaggagatattcttgcattgcatggga
tactcgatcactcgcggccttaacttagccctgcgtcttatcaagaactcggagggtgcc
ttgggctacaccatcaacacctccaccatacagttggtggacgaactgcatccgctttgt
gatgaggacgatataacctttcggcagcgaaacaactctgctctgcacatcaagatcttc
agcaacaacctatttaatattgatgtgccccggcttccggctcagcctgctctaccaaag
gtcagccaacgcgagccgccaaagccccaccagcagcagcaacagcagcaaccacagaag
gctaaggccaagaagcagacgaccaggtcgcaaaagtaa

DBGET integrated database retrieval system