KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA22607Help
Entry
Dpse_GA22607      CDS       T01032                                 

Definition
(RefSeq) GA22607 gene product from transcript GA22607-RA
  KO
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Protein processing in endoplasmic reticulum
Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dpse_GA22607
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dpse_GA22607
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dpse_GA22607
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dpse_GA22607
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dpse_GA22607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 1248 aa AA seqDB search
MSTIEFETIGSRLQSLEAALQAQNESHEQIVLSRPRGGSSGVSGGSSSLARVQPAPAAPG
SLAATSTTVGSAISIASRPAPPVPQPAQAPTAGVYGGTFIPPTTRSPRPTPNLPLSEAGT
NRRRMILSLPTQPHPSETETDKKLKIIMAQTGKLNINGLQYPTDIHDLRHLGDLGNGTSG
NVVKMLHVSSDTIIAVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDV
WICMELMSMCFDKLLKLSKKPVPECILGKVTVATVNALSYLKDKHGVIHRDVKPSNILID
ERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVEL
ATARSPYEGCNTDFEVLTKVLDSEPPCLPSGEGFNFSHEFHDFVIKCLTKNHQDRPKYPE
LLVQPFIRTYETAKVDVPNWFQMVMETAGKRLRANGDPTLKRPTTTTTTTTKTTTTTVGN
GAAGEPVMGPGSGAAPTKYGRAAISYQAPSTMNPQKTIKPTQIPSYQQPQAHQQQQQQSQ
SQSQYFIQSATQLPQKTTTKTTTTAGTTTNCFGHSGGSRSGSSSASPLSPASGLSASPLS
PPSGGISASPLSPPGGISDISKLYRKSPFMQRKLSNGNPQHYQQQHYKYSDESPKKESMF
SSIGQSILRNLTTSPFSQKKHHSTSSSSASTTPTATKSTGIPTLPHNNQTATTTDKTASA
APTSTPTTTTATATAPSTPQWRRPADSPLAYDSCDSSSNVNANANASTLTLGLSSPSPSL
QRRPFPTEIQTQAATTGSSVTLQLNSQLQQQQQQQPQRLQPGNQSPIVLQRFYHQQNQLR
EKEAAERYQQQRQQPVGGTSTNPFHSNYVPPPPSTHSTSSQSSTQSTCSQIAAPLASLSP
PGATAAAAAAGHFGVGSAEQLQYQPLPLTTAEVATSPRSPEQPQPQPLHHQQQHPQMEYG
GGGGGGGGGGGGVGGSMVASKLSKLYARRQLLGQSSSSRASSNSLDAKEQHDAGWFNTLA
GAMKRQFATYVKTQLNSTATSPVASAGEPQPHLLPMESMSSPLQLQSQSQLQLQSQPQMQ
SQVQPPAYRSVVNNGGGGKAYYYRTLSAASSSSNTSQSTSPTTEPLASSAGFLRRYASSG
TGPGGGGSISTPPSPHILAGLDRRHRSPDPPPRYNRGQSPLLLRKNLLELSGQPPGSPLL
HRRYVSASPPLPPPRRGSESVPGSPQHFRTRIHYTPEPQRRIYRTIDQ
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccatcgaattcgaaacgattggcagccgactgcagtcgctggaggctgcgctg
caggcgcagaacgaatcccatgaacaaatcgtcttatcgaggccgcgcggcggcagcagc
ggcgtcagcggaggctcctcatcgctggcgcgtgtccaaccagcaccggctgcccccggt
agcctcgccgccacctccaccacagttggatcggccatcagcatagcctctagacccgcg
ccaccagttcctcagccagcgcaggcccccacggcgggcgtctatggcggcacctttatc
ccgcccaccaccaggagtccgcgtcccactccaaacctgccactgtccgaggctggcacg
aatcggcgccgtatgatcctgtcgctgcccacacagccgcacccctcagaaacggagacg
gacaagaagctgaagatcatcatggcccagacgggcaagctgaacataaacgggctccag
tacccgacggacatccacgatctgcggcacctgggcgacctggggaacggaaccagtggc
aatgtggtgaagatgctgcatgtgtccagcgatacgatcattgccgtgaagcaaatgcgg
cgcacgggcaacgcggaggagaacaagcgcatcctgatggatctggatgtggtgctcaag
tcccacgactgcaaatacattgtcaagtgcctcggctgctttgtgcgcgacccggacgtg
tggatctgcatggagctgatgtccatgtgcttcgacaagctgctcaaactctccaagaag
ccggtgcccgagtgcattctcggcaaggtcacagtggcgacggtcaacgccctgtcgtat
ctgaaggacaagcacggggtcatccatcgggacgtgaagccctcgaacatactgatcgac
gagcgcggcaacatcaagctctgcgactttgggatcagcggtcgtttggtggactccaag
gccaacacgcgctcggctggctgtgcggcgtacatggcgccggaacgaatcgatccaaag
aaaccaaagtatgacatacgcgccgatgtctggtcgctgggaatcacgctcgtggagctg
gccactgcgcgatctccctacgaaggctgcaacacggactttgaggtactcaccaaagtg
ctggactcggagccgccctgcctgcccagcggcgagggcttcaattttagtcacgagttt
cacgattttgtcatcaagtgcctcacaaagaaccatcaggatcgacccaagtacccggag
ctcctggttcaaccgttcataaggacctatgagacagccaaagtagatgttccaaactgg
tttcagatggtcatggagacggccggcaagcggctgcgcgccaatggcgatcccacgctg
aagagaccaacaacaacaacaaccacaacaacaaaaacaacaacaacaacagttggaaat
ggtgcagccggagaaccagtgatgggaccaggatcaggagcagccccaacaaaatacggc
agagcggcaatatcctaccaagctccgagcaccatgaatccacagaagacaataaaaccc
acgcagataccaagctaccagcaaccacaggcgcatcagcaacagcaacagcagtcgcag
tcgcagtcgcagtatttcatacaatcagccacacaactacctcaaaaaacaacaacaaaa
acaacaacgacagcaggaacaaccacaaactgcttcgggcacagcggtgggagcaggagc
ggtagcagcagtgccagcccactgtcgccggccagtgggttaagcgccagcccgctgtcg
ccgccgagtggaggcatcagcgccagcccactgtcgccacccggtggcatcagcgacata
agcaaactgtaccggaagtcgcccttcatgcagcggaagctgagcaacggaaaccctcaa
cattatcagcagcagcactacaaatacagcgatgagagccccaagaaggagtcgatgttc
agcagtattggccaatcgattctacgcaatctgacgacatcgcccttcagccaaaagaaa
caccattcaacatcgtcatcgtcggcatcgacgacaccaacagcaacaaaatccacagga
ataccaacactgccgcacaacaaccaaaccgcaacaaccacggataaaacagcatcagca
gcgccaacgtcaacgcccacaacaacaacagcgacagcgacagcacccagcacgccccaa
tggcggcggccagcggatagtcccttagcctacgacagctgtgatagtagtagtaatgtg
aatgcgaatgcgaatgcgagtaccctgaccttgggcctatcctccccctcgccatcgctg
cagcgcaggccatttcccacagagatacaaacgcaggcggcaacaacaggctcgtcggtg
actttgcagctgaacagccaactgcagcagcagcagcagcaacaaccacagcgcctgcag
ccaggaaatcaaagccccatagtgttgcaacgcttctaccatcagcagaaccagctccgc
gagaaggaggccgccgagcggtaccaacagcagcgccagcagccagtcggcggcaccagc
acgaatccattccacagcaactacgtgccgccgccgccctcgacgcactccacatctagt
cagtcgtccacgcagtcgacgtgctcgcagattgcggcccccctcgccagcctatcgccg
cccggagcgacggctgcggcggcggcagcgggacactttggggtgggcagtgcggagcag
ctgcagtaccagccgctgcccctaacgacggcggaggtggccacaagtcccagatctcca
gagcagccgcaaccgcagcccctgcaccaccagcagcagcatccacaaatggagtatggc
ggtgggggaggcggtggcgggggcggtggcggtggcgttgggggatcgatggtggccagc
aagctcagcaagctgtatgcccgccgccagcttttgggccagagctcgagcagcagggcg
agcagcaacagcctggacgcgaaggagcagcacgacgcgggctggttcaacaccctcgcc
ggcgccatgaagcgacaatttgccacctatgttaaaacccaattgaattccacagccacg
tcaccggtggccagcgcgggtgagccacagccacacctcctgcccatggagtccatgtcg
agtcctcttcagctccagtcgcagtcgcagttgcagttgcagtcgcagccacaaatgcag
tcgcaggtacagccgccggcctacaggagtgtcgtgaacaacggaggaggcggcaaggcc
tactactatcgcaccctctccgcggcgagcagcagcagcaacaccagccagagcacctcc
cctaccacggagccgctggccagcagcgctggcttcctgcggcgctatgccagcagcggt
accggtcccggaggcggaggcagcatcagcacaccccccagtccgcacatcctcgcagga
ctggatcgcaggcaccgcagtccggatccgccgccacgctacaatcgcggccagtcgccg
ttgctgctacgcaagaatctgctagagctgagtggacagccgccgggctccccgctgctc
catagacgatatgtgtcggcgtcgccgccgttgcccccgccgcgtcgcggctctgagagc
gtgcccggatcgccgcagcacttccgcacccgcatccactacacccctgagccccagaga
cgcatctatcgcaccatagatcaatga

DBGET integrated database retrieval system